KEGG   Pichia kudriavzevii: C5L36_0C11150Help
Entry
C5L36_0C11150     CDS       T06133                                 

Definition
(RefSeq) uncharacterized protein
  KO
K05292  GPI-anchor transamidase subunit T
Organism
pkz  Pichia kudriavzevii
Pathway
pkz00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
pkz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pkz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    C5L36_0C11150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-GeneID: 40385005
NCBI-ProteinID: XP_029322687
Position
3:complement(2406274..2408268)
Genome map
AA seq 664 aa AA seqDB search
MKLEYLYWILPLVVHVIGTEFASSDEGTIAYSEHVTGSRNCLPEEQSDIIESSHLVQTST
LDTNQEEVDQSEPKTLPLSAKYDYDGKKYPNTEHLEIKPLQGGNILMSFNFEASRTTELY
PSSKEITYYDVFPKALGSILKSTNTRELHLRFGHGWYDSDLNGKLVANGNLSGGTGVEIW
AFIEANSEDEAFEYWVQLANSLSGLFCASFNSIDSAVTTKPEQLFQKESNIDTNSNLLGQ
LYHFRSALPREPICTENLTPFLKLLPTKGKQGISSLLSGNKMFNAEWTSMSIDILTNCED
GGVDNCTQSLKQAINLILNVPKVKDKNKYPIPKPTPGTELKCDPSRIHDLYNCFPLVESP
DLDFTFLDLFGKVIRGGSLVASKPSTVCFDIDLNNWEIGHLSLQPPDQFYMDEKLCFSLL
TSDEYNVSFKTHDSSKVNNIEQPPFRASRSLSGYSQESGGFRLDFFNPTEGDQVIVIFQA
LPWFVKLYTHSLVLTVTNKSGESVLLNVQNEELSEYIKEIVYHPAVDRVTPTHLELRILA
PAKTKLKFTFSFDKSMLLYSEYPPDANHGFELEPVVFALIDKDHPDNVKYIMRTTTGLLT
LPTPDFSMPYNVIILTLTIMSLTFGSIFNLLVKKVVTEEEAELAQSERPVEKLKQKFRTL
FGRT
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgaatacctgtattggattttaccattggtggttcatgttattggtacggag
tttgcaagtagcgatgaaggaacaattgcatattctgaacacgtcacaggaagtaggaat
tgtttgcccgaggaacaatccgacatcatagaaagttcacacttggtccaaactagtaca
ttggatacaaatcaagaagaagttgaccagtctgaaccaaagactttgcctttatctgca
aaatatgattacgatggcaaaaagtatccaaatactgaacatttggagataaagcctttg
caaggcggtaatatcctgatgtcgtttaattttgaagctagcaggactacggaattgtat
ccttcctctaaagagattacatattatgatgtttttcccaaggcattggggtccattctc
aagtcaaccaatacaagggagctacatctcagatttgggcacggttggtatgattctgac
cttaatgggaagcttgttgcaaatggaaatctaagcggtggtactggtgttgagatttgg
gcatttattgaggcgaattcagaagatgaggcattcgaatactgggtccagttggccaat
tccctttcaggtcttttttgtgcatcttttaattctatcgattcagctgtgacgaccaag
ccagagcaactctttcaaaaagaaagcaacattgatacaaacagtaacttgcttggtcag
ctgtatcattttagaagtgcattgccgagagagccaatatgcacagaaaacttaactccg
ttcctaaagttacttccaacgaagggaaaacaaggaatttcatcattactctcggggaac
aaaatgttcaatgcagaatggacatccatgtctatagatattttaacaaactgcgaggat
ggaggggtagataattgtactcagtctctgaaacaagctatcaacttgattcttaacgta
cccaaggttaaggacaaaaataaataccctattcctaaaccaactccaggtactgaactt
aagtgtgatcctagtcgaattcatgatctttacaactgtttccccctagttgaatcacca
gacttagattttacatttcttgatctgtttgggaaggtgataaggggtggttcgttggta
gcatcaaaaccttccaccgtttgttttgatattgatctaaacaattgggagattggacac
ttatccctgcaacctccagatcagttttacatggatgaaaaactatgcttttctctgttg
acgagtgatgaatacaacgtatcttttaaaactcatgacagctcaaaagtcaataacata
gaacaacctccttttcgagcttcaagatccttatccgggtattctcaagaaagtggtggg
ttccgacttgatttcttcaatcccacagaaggagaccaagtaattgttattttccaagct
ctgccctggtttgtgaaactatacacacattctttggtattaactgtgacaaataaaagt
ggtgaatctgtactgttgaatgttcagaatgaagaattgtcggaatatatcaaagaaatt
gtttaccatcctgcggtcgatagagttacgccaacacatttagagctgaggatactagcg
ccagcaaagacaaaactcaaatttacgtttagttttgataaatcaatgttactatactcg
gagtatccgcccgatgctaaccatggctttgagttagagccagttgtgtttgctttgatt
gacaaggaccatcctgacaacgtgaaatatataatgcgtacgacaactggtctcctaact
cttcctactccagatttctctatgccttataatgttatcatattgacattgacgatcatg
tccttaacgtttgggtccatctttaacctcctcgtcaaaaaggttgttactgaagaggaa
gcagaacttgctcagagtgaaaggccagttgaaaaactgaaacaaaaatttcgcacctta
tttggaaggacctga

DBGET integrated database retrieval system