KEGG   Pichia kudriavzevii: C5L36_0D00720Help
Entry
C5L36_0D00720     CDS       T06133                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pkz  Pichia kudriavzevii
Pathway
pkz00260  Glycine, serine and threonine metabolism
pkz01100  Metabolic pathways
pkz01110  Biosynthesis of secondary metabolites
pkz01130  Biosynthesis of antibiotics
pkz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pkz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C5L36_0D00720
Enzymes [BR:pkz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     C5L36_0D00720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 40385162
NCBI-ProteinID: XP_029322810
Position
4:complement(130484..131620)
Genome map
AA seq 378 aa AA seqDB search
MPEQTQQFPTHNEFRSDTFTVPTQKMLESVLTCTVGDSVYKEDQDCLDLEDKVARLSGHE
AALFCSSGTMSNQIALRAHLFQPPHSILCDYRAHVYSHEAGGLATLSQAMVSPVRPANGN
YITLDDILENYIPDDGDIHMAPTKVVSLENTLHGIITPYEEIERISQWCKETGILLHCDG
ARLWNASAETGISIHDYCRLFDSVSLCLSKSLGAPFGSILVGKKKFIEKCNHFKKQNGGG
IRQAGMLAKMASIAIDDNFDKIKISHQYAKNVGQFCVEKGIPLESPVDTSFVFLDSKKFK
VNPSTYDIISKKYNVRTMGNRLAFHYQNSPEAIENLKSALLEAYQDSLVHPYTTKGAAKL
YRTPSVSSTKTLVEHVHH
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacaaacacagcaatttccaacccataacgaattcagaagtgatacattcact
gtgcctacccagaagatgctggaatcggtgctgacttgcactgttggtgactctgtttac
aaggaagaccaagactgtcttgatctcgaagacaaggtggcgaggctaagtggacatgaa
gctgccctattttgctcctccggtacaatgtcaaaccaaatcgccctaagggcacactta
ttccagcctccacactccatcctctgcgactacagagcccatgtctactcgcacgaggcc
ggtggattggccactctctcgcaggccatggtttcgccagtcagacccgccaatggaaat
tacataacattggatgatatcttggaaaattacatcccggatgacggtgacattcatatg
gcaccaaccaaggttgtctcgttggagaacaccttgcatggtatcataaccccgtatgaa
gagattgagcgcatttctcaatggtgcaaagaaacgggtattctcttacattgtgacggt
gcaaggctatggaatgcatccgcagaaactggtatctccatccacgattactgtagattg
tttgattccgtctccctttgtttgtcaaaatctttgggtgcaccatttggttcaattctt
gttggtaaaaagaagtttattgaaaaatgtaaccatttcaaaaagcaaaatggtggtggt
attagacaggcgggtatgttggccaagatggcttccattgcaatcgatgacaactttgac
aagatcaaaatctcccatcaatatgctaaaaatgtcggccagttttgcgttgagaaaggt
atacctttggaatcaccggttgatacatcgtttgtgtttcttgattccaagaagttcaaa
gttaacccttcaacttatgatatcatttccaaaaaatacaatgtcagaacaatgggtaac
agactggctttccattatcagaattccccagaagctatcgaaaacctaaagtcggcgtta
cttgaggcgtaccaagattccttggtccatccgtatacaaccaaaggtgcagcaaaactg
tatcgtactccttccgtcagttcaactaaaacattagttgagcatgttcatcattaa

DBGET integrated database retrieval system