KEGG   Pichia kudriavzevii: C5L36_0D03075Help
Entry
C5L36_0D03075     CDS       T06133                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
pkz  Pichia kudriavzevii
Pathway
pkz00520  Amino sugar and nucleotide sugar metabolism
pkz01100  Metabolic pathways
pkz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pkz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C5L36_0D03075
Enzymes [BR:pkz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     C5L36_0D03075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 40385401
NCBI-ProteinID: XP_029323049
Position
4:complement(632330..633259)
Genome map
AA seq 309 aa AA seqDB search
MGQLLEYGVTSICPTVTSSQQHVYHDVIPILGLKTRSSNKADSLGVHLEGPFISPIKKGC
HPPEAITDMKHGYISLQERYGQGFEQYAAIVTAAPEVQGCSEIIPQLTSNSPTVFSIGHT
MADFDLALSAVHSGATMITHLYNAMPAHTARDVGVLGLISATKDTLPSDKIPFYGIIADG
VHVHPSAVRAAYMANPSKTILVTDALYLIGLEDGHYQRGNQSVQKKGSLLLLQGTDTIAG
SATHLIDCVHNLIKWTGIPLAEALATITNNPATSLNIAHRKGFLRPGCDADLNILSADGT
LKDTYKLYH
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggggcagctcttggagtatggtgtcacgagtatttgtcccactgtcacatcgagccag
caacatgtataccatgacgttatccccatcctaggcctcaaaactcgatcttcaaacaag
gccgattctcttggtgtccatctagaaggccccttcatttcacccatcaaaaagggctgc
catccgccagaggcaattactgatatgaagcatggctacatctccttgcaggaacgatac
ggccaaggttttgagcaatacgctgcaatcgtgactgctgctccagaggtacaaggctgt
tccgaaattataccacagctaaccagcaacagccccaccgtattttccatcggacatacc
atggctgactttgatcttgcccttagcgccgtacacagcggtgctacaatgattacccac
ctctacaatgcaatgcccgcccatacagccagagatgttggtgtacttggtctgatatct
gctacaaaggataccttaccttcagataagattcccttctatggtattattgccgacggt
gtgcatgtccatcctagtgccgtccgggcggcttacatggccaatccctcaaagactatc
cttgtcaccgatgccttgtatttgattggtttggaagacggccactaccagagggggaat
cagtcggttcaaaagaaagggtctttgctactgctacaaggtaccgataccatagcggga
tcggcaacccatttgattgactgtgtacacaatctcatcaaatggacaggtatacccctt
gcagaggccctggcaaccatcaccaacaaccctgctacatctctcaatattgcacaccga
aaggggtttctaaggcctggctgtgatgccgatctcaatattctgtctgcagatggcaca
ctgaaggacacttataagttatatcactaa

DBGET integrated database retrieval system