KEGG   Pichia kudriavzevii: C5L36_0E01370Help
Entry
C5L36_0E01370     CDS       T06133                                 

Definition
(RefSeq) uncharacterized protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
pkz  Pichia kudriavzevii
Pathway
pkz00564  Glycerophospholipid metabolism
pkz01100  Metabolic pathways
pkz01110  Biosynthesis of secondary metabolites
Module
pkz_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:pkz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    C5L36_0E01370
Enzymes [BR:pkz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     C5L36_0E01370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase C2
Motif
Other DBs
NCBI-GeneID: 40385934
NCBI-ProteinID: XP_029323551
Position
5:280359..283058
Genome map
AA seq 899 aa AA seqDB search
MDHATQQVFNNQLVSSGVKIPIVFSVQERLENGTLGDCRIKDVSILKDHLTSSIIFDISK
NRLSEYTVKFEVSICNLASIQRLQLNNDSIKAVVYLENEKTSSILETISLKNLLELGSKK
VSHFTKTLNEFHLDLNFSIDSSDKRTEEEITNHFTTLRLPYSPQSDLTSLPSYFSSDISS
TNQSFASLNSLSPPSRPNSTCSKKKSIPNFLKPSLKGSSKTNSNIDISTSNPDLYHEDTD
GFLILQIESATGLPPFKKKTQLGYDMDPFVVVSFSKQIYKTNVCRHALNPSWKNQLINIR
VSKYSLKFLLKLSVYDFDVFTFNDDICSTSLEIGDLINESEHNSNDTWTYKKLPLSFSDR
ALSKKLLKTQNYMPELSIRFKYVPVSTLAGLVHSFNPTKTRCPYCHKLDKKHASALQHLS
ICRMGLKPSQFLHKHYTTSNHASRRWYVKILAHIAYGRLTVGGNNAHILVQDRVTGLVLE
EKISVFVKLGIRLLYKSVKSDNSSEKIKKMLRSLSIKQGAKYDKPSSKSKIEEFVKFHGL
KSTLVECENPDLSSYRTFNEFFSRKLKSDARPLEGGTDNQIIVSVADSRLIVFNDISSAK
NLWIKGNGFTVDKLLGRKETGEVKFKYSIAIFRLAPQDYHRVHLPLNGKIVKINHIHGSY
YTVNPMAIRSALDVFGENVRTVITLETEEYGDVELVMVGAMMVGSIILSVKVNDIVKKGQ
ELGYFKFGGSTVILVFRNSREDSNMPKMVWDGDLLSNSNKKLETLVKVGMSVGHSVRSKE
FRRGVKKEVSDSERREIIRRVTGIPENPTPGVGDNIKAKLGGMIDDVMSTKSVKSYNQRN
EIENMLQSDWEIKELTTLEGLNDNGELRDQIDIDVTRGFDGTNFFHMLDNSDEYNSLDK
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atggaccatgccacgcaacaggtgttcaacaaccagcttgtctcatcgggcgtgaagatc
cccattgtgtttagtgttcaagaacggctggagaatggcacccttggagattgtcggatc
aaagacgtatccattctgaaggatcacttgacatcgtctattatttttgacatttccaaa
aatcgtttgagtgaatacactgtgaagtttgaagtatcaatctgcaatctggcatccatt
caaaggttacaattaaataacgattccatcaaagctgtggtatatttagaaaatgagaaa
actagctcaattctagaaactatatcactgaaaaatttgctggaattgggttcaaagaag
gtttcccattttacaaaaactctcaatgaatttcaccttgatttaaatttcagcatagac
tcttctgacaaaaggacagaagaagaaataacgaatcatttcactaccttgcgacttccc
tattcccctcagagcgacctaacctcactaccatcatatttttcctccgatatctcaagt
acaaaccaatctttcgcgtctttgaattcactatctccaccatcacgtccaaattcaaca
tgttcgaagaagaagtccatacctaatttcttgaagccctcgttaaagggtagttccaaa
acaaactcaaacattgatatatcaacttcaaatccagacctgtatcatgaagacaccgat
ggatttctaatccttcaaatagagtcagccacaggattgccgcctttcaagaaaaaaaca
caactgggctatgatatggatccatttgtcgtagtctctttctcaaaacagatctacaaa
acaaacgtttgtaggcatgcactcaatccatcatggaaaaaccagctaatcaatattcga
gttagtaagtactctttgaaatttctgctgaaactttccgtctatgattttgatgtcttt
acatttaatgatgatatctgctctacatctctggaaattggtgatctaatcaatgaatcc
gaacataatagtaatgatacttggacttacaagaagttaccgctaagtttctccgatcgt
gcactctcgaaaaagcttttaaagacccagaattatatgccagagctctcaataaggttc
aagtatgttccagtcagtaccttggcaggcctagtccatagtttcaatccaactaaaact
aggtgtccatattgtcacaaacttgataaaaaacatgcatcggcgcttcagcatttgtct
atttgtcggatgggtttaaaaccaagtcagtttttacataaacactatacaacttcaaac
catgcatcaaggagatggtatgtcaaaatcttagctcatatagcttacggtagattaact
gttggtggaaataacgcccacattttggtccaagatagagttactggattagttttggag
gagaaaatttcggttttcgtcaagttaggtattaggttgttatataagtctgtcaagtct
gataattccagcgaaaagatcaagaaaatgttgagatccctttcgattaaacagggtgcc
aagtatgataagcctagctccaagtctaaaattgaggaatttgtcaaatttcatgggtta
aaatcaacactagtggaatgtgaaaatccagacttatctagctatagaacattcaatgaa
tttttcagccggaaactgaaatcagatgcaagaccccttgaaggtggtacggacaaccag
ataattgtatcagtggctgattctagactgattgttttcaatgacatttcgtcggctaaa
aacttgtggattaaaggtaacggatttaccgttgataaactactgggtaggaaagaaacc
ggggaagttaaattcaaatattcaattgccatcttcaggttggctcctcaagattaccac
cgtgttcatcttccactcaatgggaaaatagttaaaatcaatcatatccacggttcttat
tatacagtgaatccgatggcaatcagatctgcattggatgtttttggtgagaatgttaga
actgtaattacccttgaaactgaagagtacggggacgtcgaactagtcatggttggtgca
atgatggttggcagtattatcctatctgtcaaggtgaatgatattgttaaaaaaggccaa
gaattggggtatttcaaatttggtggttcaacagttatacttgtctttagaaacagcaga
gaggactcgaatatgccaaaaatggtatgggatggtgatttgttatccaattcgaacaaa
aaattggaaactctagttaaagttggcatgagtgtaggtcattctgttagaagcaaagaa
ttcaggagaggcgtcaagaaagaagtttcggatagtgagagaagagaaattatccggagg
gttacaggtattccagagaatccaacaccaggggtcggagacaacatcaaggccaaacta
ggcggaatgattgatgatgtgatgagtacaaagagtgttaaaagttacaatcaaaggaac
gaaatagagaatatgcttcaatcagattgggaaatcaaagagttgacgacgcttgaagga
ctaaatgacaacggtgaacttcgagatcagatcgacatcgatgtgacaagagggtttgat
ggaaccaactttttccatatgttggataatagtgacgaatataactcattggataaatag

DBGET integrated database retrieval system