KEGG   Parvibaculum lavamentivorans: Plav_0465Help
Entry
Plav_0465         CDS       T00580                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase NAD-binding
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00071  Fatty acid degradation
pla00280  Valine, leucine and isoleucine degradation
pla00281  Geraniol degradation
pla00310  Lysine degradation
pla00362  Benzoate degradation
pla00380  Tryptophan metabolism
pla00410  beta-Alanine metabolism
pla00640  Propanoate metabolism
pla00650  Butanoate metabolism
pla00903  Limonene and pinene degradation
pla00930  Caprolactam degradation
pla01040  Biosynthesis of unsaturated fatty acids
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
pla01120  Microbial metabolism in diverse environments
pla01130  Biosynthesis of antibiotics
pla01200  Carbon metabolism
pla01212  Fatty acid metabolism
Module
pla_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Plav_0465
   00650 Butanoate metabolism
    Plav_0465
  Lipid metabolism
   00071 Fatty acid degradation
    Plav_0465
   01040 Biosynthesis of unsaturated fatty acids
    Plav_0465
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Plav_0465
   00310 Lysine degradation
    Plav_0465
   00380 Tryptophan metabolism
    Plav_0465
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Plav_0465
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Plav_0465
   00281 Geraniol degradation
    Plav_0465
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Plav_0465
   00930 Caprolactam degradation
    Plav_0465
Enzymes [BR:pla01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Plav_0465
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Plav_0465
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Plav_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 AlaDh_PNT_C 2-Hacid_dh_C NAD_binding_2 F420_oxidored NAD_binding_8 UDPG_MGDP_dh_N DAO Pyr_redox_2 ApbA
Motif
Other DBs
NCBI-ProteinID: ABS62088
UniProt: A7HQA5
Position
503087..505339
Genome map
AA seq 750 aa AA seqDB search
MTPYENFKFELDADGIALITWDMPGRSMNVLSQSSMADMASIIEKIMSDDAIKGAVLTSG
KDAFCAGADLSMMGGQAGGSGSGSQEDRVKAMYEGNLKFNMLLRGLETCGKPVVAAINGT
ALGGGLEVTLACHYRIASDNPKTQIGLPEAKVGLLPGGGGTQRLPRLIGAQAALPLILQG
TSLDPQKALKAGILHKVVPAAELIPAAKAWLKEGLAQPKVKLGKKGPEVYAIAIQPWDRE
GYKVPGGDPNGKGGSQVFTIGNATLHKQTHGNFPAQKFIMSCVYEGLQVPIEAGLRIETR
YFTKLLMDPRSKAMIRSLFLSMQELAKGARRPSGVPAFQVKKLGILGAGMMGAGIAYVSA
QAGMEVVLLDTDQANAEKGKAYSEKLLKKALERGKTTQEKADKLLGLIKPTTNYDDLKGA
DLVIEAVFESRDIKAEVTKKAEPMLAAGGIYGSNTSTLPITGLAEASAKPDNFIGIHFFS
PVDKMQLVEIIMGKKTSDETLAKAMDYVKQIRKTPIVVNDSRGFYTSRCFGTYVGEGLAM
LGEGVPPAMIENVGKMTGMPMAPLALNDEVSLDLAYKVREQTKKDLGDKYVGSPADDLVK
KMVVDLGRVGKKAGKGFYDYPADGKKKLWPGLADLAGKSQDPDDLDVQELKNRFLYIQAL
EAARCFEEGVVTDVRDADVGAILGWGFAPWAGGPLSLIDMVGTKEFVEACDKLAQKYGPR
FTPGKLLRDMAEKGDTFYGRFAPSKEKAAA
NT seq 2253 nt NT seq  +upstreamnt  +downstreamnt
atgaccccttacgaaaatttcaaattcgaactcgacgcagacggcatcgccctcatcacc
tgggacatgcctggccgttcgatgaacgtcctctcgcaaagctcgatggccgatatggcc
tcgatcatcgagaagatcatgtcggacgatgccatcaagggcgccgtcctcacctccggc
aaggatgccttctgcgccggcgccgatctctccatgatgggcgggcaggccggcggttcg
ggcagcggctcgcaggaagatcgcgtcaaggcgatgtatgagggcaacctcaaattcaac
atgctgctgcgcggcctcgaaacctgcggcaagcccgtggtcgccgcgatcaacggcacc
gcgcttggcggcggcctcgaggtcacgcttgcctgccattaccgcatcgccagcgacaat
ccgaaaacgcagatcggcctgcccgaagcgaaggtcggcctcctgcccggcggcggcggc
acgcagcgtctgccgcgtctcatcggcgcgcaggccgccctgccgctgatccttcagggc
acctcgcttgatccgcaaaaggcgttgaaggccggcatcctccacaaggtcgtgcccgcc
gccgaactcatcccggccgccaaggcatggctgaaggaaggtctcgcccagccaaaggtc
aaactcggcaagaagggccccgaggtttacgccatcgccatccagccctgggaccgcgaa
ggctacaaggtgcccggcggtgacccgaacgggaaaggcggaagtcaggtcttcaccatc
ggcaatgccacgctgcacaagcagacgcatggcaacttcccggcgcagaagttcatcatg
tcctgcgtctatgaaggactccaggtgccgatcgaggcggggctccgcatcgagacgcgc
tacttcaccaagctgctgatggacccgcgttccaaggcgatgatccgttcgctcttcctc
tccatgcaggaactcgccaagggcgcgcgccgcccgtcgggcgttcccgccttccaggtg
aagaagctcggcattctcggcgcgggcatgatgggtgcgggcattgcttatgtctcggcc
caggccggcatggaagtcgtgctcctcgacaccgatcaggcgaatgccgaaaagggaaag
gcctattcggagaaacttctgaagaaggcgctcgaacgcggcaagaccacgcaggaaaaa
gcggataagctgctcggccttatcaagccgacgacgaattacgacgacctcaagggcgcc
gacctcgtcatcgaagctgtgttcgaaagccgcgacatcaaggcggaagtgacgaagaag
gccgaaccgatgctcgctgctggcggcatctacggttccaacacctcgacgctgccgatc
accggtctcgcggaagcctccgcgaagcccgataacttcattggcatccacttcttctcg
cccgtcgacaagatgcagcttgtcgaaatcatcatgggcaagaagacgagcgacgaaacc
ctcgccaaggcgatggactacgtgaagcagatcaggaaaacgccgatcgtcgtcaacgac
agccgcggcttctacacctcgcgctgcttcggcacctatgtcggcgaagggctcgccatg
ctgggcgagggcgtaccccccgccatgatcgagaatgtcggcaagatgaccggcatgccg
atggcgccgctcgccttgaacgacgaagtctcgctcgatctcgcctacaaggtgcgcgag
cagacgaagaaggacctcggcgacaaatatgtcggctcgccggcagacgatctcgtcaag
aagatggtcgtggacctcggccgcgtcggcaagaaggcgggcaagggcttctacgactat
cccgcagacggcaagaagaagctctggccgggcctcgcagatctcgccggtaaatcgcaa
gaccccgacgacctcgatgtgcaggagctgaaaaaccgcttcctctacattcaggcgctc
gaagccgcgcgctgcttcgaggaaggcgtggtgaccgacgtgcgcgatgcggatgtcggc
gccatcctcggctggggcttcgcgccctgggccggcggcccgctctcgctgatcgacatg
gtcggcacgaaagagtttgtcgaagcctgcgacaagcttgcccagaaatacgggccccgc
ttcacgccgggcaagctcctgcgcgacatggccgaaaagggcgacaccttctacggccgc
ttcgcaccgtcgaaggagaaggcggccgcctga

DBGET integrated database retrieval system