KEGG   Parvibaculum lavamentivorans: Plav_1372Help
Entry
Plav_1372         CDS       T00580                                 

Definition
(GenBank) Methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00670  One carbon pool by folate
pla01100  Metabolic pathways
pla01120  Microbial metabolism in diverse environments
pla01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Plav_1372
Enzymes [BR:pla01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     Plav_1372
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     Plav_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH
Motif
Other DBs
NCBI-ProteinID: ABS62992
UniProt: A7HSV9
Position
1504722..1505618
Genome map
AA seq 298 aa AA seqDB search
MTATIIDGKIIATELRARVAVEVARLKKDHSLTPGLAVVLVGNDPASEVYVRNKGIATTE
AGMNSFEFKLPAETSEADVLAKVRELNADPAVHGFLVQFPVPNHISQQAVIDAIDPVKDA
DGLHPLNAGRLASGLPAMVPATPEGCVIMAKRAGGDLSGKHAVIIGRSNLVGKPVAQLLL
KENCTVTIAHSRSRDLPSIARQADILVAAVGRPGMVRGDWVKPGAVVIDVGINRVPAPEK
GEGKTRLVGDVLFDEAAEVAGAITPVPGGVGLMTVACLLRNTVIAACRQNGIALPQDF
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaccatcatcgacggcaagatcatcgcgacggagctgcgcgcccgcgtcgcc
gtcgaagtcgcacgcctgaaaaaagaccatagcctcacgcccggcctcgccgtcgttctc
gtcggcaacgatcccgcaagcgaggtctatgtccgcaacaagggcatcgcgaccacggaa
gcgggcatgaactccttcgaattcaagctgcccgccgaaacaagcgaggcggacgttctc
gccaaggtgcgcgagctcaatgccgatcccgccgttcacggtttcctcgtgcagtttccc
gtccccaatcacatcagccagcaggcggtgatcgatgcgatcgatccggtgaaggacgcc
gacggtcttcatccgctcaatgccggccgtctcgccagcggtcttcccgccatggtgccg
gcgacgcccgaaggctgcgtcatcatggcgaagcgcgcaggcggcgatctctccggcaag
catgccgtcatcatcggccgctccaaccttgtcggcaaacctgtcgcgcaattgctgctg
aaggaaaactgcaccgtcaccatcgcgcatagccgctcgcgcgacctgccgtcgattgcg
cggcaggcggatattctcgtcgccgcggtcggccgccccggcatggtgcggggcgactgg
gtgaagcccggcgccgtggtcatcgatgtcggtatcaaccgcgtgcccgcgccggaaaaa
ggcgagggcaagacgcgccttgtgggtgacgtccttttcgacgaggcggcggaagtcgcg
ggcgcgatcacgccggtgccgggcggcgtcggcctgatgacggtggcctgcctgcttcgt
aacacggtcatcgccgcctgccgtcagaacggcattgccttgccgcaggatttttga

DBGET integrated database retrieval system