KEGG   Parvibaculum lavamentivorans: Plav_1377Help
Entry
Plav_1377         CDS       T00580                                 

Definition
(GenBank) Argininosuccinate synthase
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00220  Arginine biosynthesis
pla00250  Alanine, aspartate and glutamate metabolism
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
pla01130  Biosynthesis of antibiotics
pla01230  Biosynthesis of amino acids
Module
pla_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:pla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Plav_1377
   00220 Arginine biosynthesis
    Plav_1377
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pla04147]
    Plav_1377
Enzymes [BR:pla01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     Plav_1377
Exosome [BR:pla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Plav_1377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginosuc_synth Asn_synthase QueC
Motif
Other DBs
NCBI-ProteinID: ABS62997
UniProt: A7HSW4
Position
complement(1509134..1510366)
Genome map
AA seq 410 aa AA seqDB search
MSGATKDVKKVVLAYSGGLDTSVILKWLQETYGCEVVTFTADLGQGEELEPARKKAEMLG
VKEIYIEDLREEFVRDFVFPMFRANAVYEGVYLLGTSIARPLIAKRQIEIARQTGADAVC
HGSTGKGNDQVRFELGYAALNPEIKIIAPWREWDLTSRTKLIEFAEKHQIPIAKDKRGEA
PFSVDANLLHISAEGKVLEDPADEAPEYVYSRSVRPEDAPDTPTYVEVGFEKGDAVSIDG
VKMSPATLLTKLNELGGANGIGRLDLVENRFVGMKSRGVYETPGGTVLLVAHRAMESITL
DRGAAHLKDELMPRYAELIYNGFWWSPEREMLQALIDKSQEMVTGSVRLKLYKGMATVVG
RSSPYSLYSMAHVTFEEDAGAYDQKDAAGFIRLNALRLRLLAARNNRTKK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgcgacaaaagacgtgaagaaggtggttctggcctattcgggcgggctcgac
acctcggtcatcctgaaatggctgcaggaaacctatggctgcgaggtggtgaccttcacc
gccgatctgggccagggcgaggagctggagccggcgcgcaagaaggccgagatgctcggc
gtgaaggaaatctacatcgaggatctgcgcgaggaattcgtgcgcgacttcgtcttcccg
atgtttcgcgccaatgccgtctatgaaggcgtctacctgctcggcacatctatcgcccgg
ccgctgatcgccaagcgccagatcgagatcgcgaggcagaccggcgccgacgcggtctgc
cacggctcgaccggcaagggcaacgaccaggtccgcttcgaactcggctatgcggcgctg
aacccggaaatcaagatcatcgcgccctggcgcgaatgggacctgacctcgcgcacgaag
ctcatcgaattcgccgagaagcaccagatcccgatcgccaaggacaagcgcggcgaggcg
cccttctcggtcgacgcgaacctgctgcacatatcggccgaaggcaaagtgctggaagac
ccggcagacgaagcgccggaatatgtctatagccgcagcgtgcggcccgaggatgcgccc
gacacgccgacctatgtcgaggtcggcttcgagaagggcgacgcggtttccatcgacggc
gtgaagatgagcccggcgacgctgctgacgaagctcaacgagctgggcggcgcaaacggc
atcggccgcctcgacctcgtggagaaccgcttcgtcggcatgaaatcgcgcggcgtctac
gagacgccgggcggcaccgtgctgctcgtcgcgcaccgcgccatggagagcatcacgctg
gaccgcggcgccgcgcatctgaaggacgagctgatgccgcgctatgcggagctcatctat
aacggcttctggtggagcccggagcgcgaaatgctgcaggcgctgatcgacaagagccag
gaaatggtgacaggcagcgtgcgcctcaagctctacaagggcatggcaaccgttgtcggc
cgctcctcgccttattcgctttactcaatggcgcatgtgactttcgaggaagatgccggc
gcctacgaccagaaggacgcggcaggcttcatccgcctcaatgcgctccgcctccgtctt
ctcgcggcccgcaacaacaggaccaaaaagtaa

DBGET integrated database retrieval system