KEGG   Parvibaculum lavamentivorans: Plav_1843
Entry
Plav_1843         CDS       T00580                                 

Definition
(GenBank) conjugation TrbI family protein
  KO
K20533  type IV secretion system protein TrbI
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pla00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Plav_1843
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pla02044]
    Plav_1843
Secretion system [BR:pla02044]
 Type IV secretion system
  Trb secretion system protein
   Plav_1843
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: ABS63460
UniProt: A7HU77
Position
1994416..1995711
AA seq 431 aa
MAGPASPQGQTPPPGKVDPETLALRAKPRRVTRFRRSVVIGAAAAGSATIFALAFLALEG
SSFRLMGPDGSELYHPERKERAEGLAALPESYDEIPKPIPELGAPLPGEFGRPIVRQEAE
LGIDSGAGLRPNFVPSAEENDARAERLRLAQQARQAAEAGVFFQLKGSGSGKGSASQSRM
SDAGDSTGFQAVAVDERLHLDPKRDLSSVASAEGDQNHQQRKLDFLNRGPDQDIYNRHAL
REPVSAHQLMAGSVIAASLITGLNSDLPGLVVAQITENIFDTVSGKTLLIPQGSRLIGSY
DSVVAFGQSRALLVWHRIIMPDGSSIVIDNLPATDAAGYAGVADKVDYHTWALVKGVALA
TLLSVGTELSFGSEESDLLRAIRQSTQQNVSQAGQRLTEKNLNIQPTITVRPGWPIRVIV
QKDLILRPYRG
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggccggtcccgcttcgcctcagggtcaaacgcccccgcccggaaaagtcgatcccgaa
acgctggcgctgcgtgcaaagccgcgccgcgtgacgcgcttccggcggagcgtcgtcatc
ggcgccgcggcggcaggctcagcaacgatcttcgcgctcgcctttctggcgctggagggc
tcaagcttccgtctcatgggaccggatggctcggaactctaccacccggagcggaaggag
agggcggagggactggcggcgctgcccgagagctatgacgagatcccgaagcctatcccc
gaactcggcgcaccgcttcccggcgagttcggccgtcccatcgtcaggcaggaagccgaa
ctcggcatcgacagcggcgccggtctccgcccaaacttcgtgccgagcgccgaagagaac
gacgcccgcgccgaacgattgcggcttgcgcaacaggcgcggcaggcggcggaagccggt
gtgttctttcaattgaagggaagcggaagcgggaagggcagtgcttcacaatcgaggatg
tcagacgcgggagacagcacaggcttccaagctgttgcagtcgacgaacgcctccatctc
gatccgaagcgcgacctgtcctccgtagcttcagcggagggggaccagaaccatcagcag
cgcaagctcgatttcctgaaccggggaccggaccaagacatctataaccgccacgcactg
cgggaaccggtctcggcgcatcagctgatggccggcagcgtcattgctgcgagcctgatc
acggggttgaattccgatctgccgggccttgtcgtcgcccagatcacagaaaatattttc
gacacggtgagcgggaaaactttgcttattccgcaaggatcgaggctgatcggcagttac
gacagtgtcgtcgcctttggtcagtcgcgggcgctgctcgtctggcaccgcatcatcatg
ccggatgggtcttcgatcgtgatcgacaatctgccggcaacggatgccgccggttatgcc
ggcgtcgccgataaggtcgactaccacacatgggcgctcgtcaagggcgtggcgctggcg
acacttttaagtgtcggcaccgagcttagtttcggcagcgaggagagcgatctcctgcgc
gcgatccgccagtcgacgcagcagaacgtttcgcaggccggtcagcgtctcaccgagaag
aacctcaacatccagccgaccatcacggtgaggcccggctggccgatccgcgtcatcgtg
cagaaggacctgatcctgcgtccctatcgaggatga

DBGET integrated database retrieval system