KEGG   Parvibaculum lavamentivorans: Plav_2511Help
Entry
Plav_2511         CDS       T00580                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pla00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Plav_2511
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 CCP_MauG
Motif
Other DBs
NCBI-ProteinID: ABS64120
UniProt: A7HW37
Position
complement(2712226..2712624)
Genome map
AA seq 132 aa AA seqDB search
MRDLFHGFAAISLAMTISGAALAEGPDLADGKKIFARCKACHTLEEGGKDGIGPNLHGVF
GRTAGTKEGVKFSKAMTAKGAEGLVWSEETLSVYLEKPAAMVPGTNMAFPGLKKEEDRAS
LIAYLKSETGAE
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgacctgttccacggatttgcagcgatttcccttgccatgaccatttcgggcgcc
gcgctggccgaagggccggacctcgcggacggcaagaagatcttcgcccgctgcaaggct
tgccataccctcgaggaaggcggcaaggacggcatcggcccgaaccttcacggcgtattc
ggccgcaccgccggcaccaaggaaggcgtgaaattctccaaggcgatgacggcaaaaggc
gccgagggcctggtctggtcggaagagaccctgtcggtctatctcgaaaagccggctgcc
atggttcccggcacgaacatggctttcccgggcctcaagaaggaagaggaccgcgccagc
ctgatcgcctatctcaaatccgaaaccggcgcggaataa

DBGET integrated database retrieval system