KEGG   Parvibaculum lavamentivorans: Plav_3098Help
Entry
Plav_3098         CDS       T00580                                 

Definition
(GenBank) HpcH/HpaI aldolase
  KO
K08691  malyl-CoA/(S)-citramalyl-CoA lyase [EC:4.1.3.24 4.1.3.25]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00630  Glyoxylate and dicarboxylate metabolism
pla00660  C5-Branched dibasic acid metabolism
pla00680  Methane metabolism
pla01100  Metabolic pathways
pla01120  Microbial metabolism in diverse environments
pla01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Plav_3098
   00660 C5-Branched dibasic acid metabolism
    Plav_3098
  09102 Energy metabolism
   00680 Methane metabolism
    Plav_3098
Enzymes [BR:pla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     Plav_3098
    4.1.3.25  (S)-citramalyl-CoA lyase
     Plav_3098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI C-C_Bond_Lyase Ribosomal_L39
Motif
Other DBs
NCBI-ProteinID: ABS64705
UniProt: A7HXS2
Position
complement(3309547..3310662)
Genome map
AA seq 371 aa AA seqDB search
MRSWICDRSIARLRANRPYPQWTVMKLPSFFYKPLAIGAPAPYRELPVALERMIHFFPGH
NEKLRSRLGEIIPQVDVLLGNLEDAIPADAKEAARKGVIEVGKSHDFGSTGFWVRINPLN
SPWMLDDVTELVAEIGDKLDVIMLPKVEGAWDIHYLDQLLAQLEAKHGLKKPLLIHAILE
TAQGVKNVEEIACASPRMHGMSLGPADLAASRKMKTTRVGGGHPFYRVLEDPKEDGSPRI
AAQQDLWHYTFAKMVDACVANDIRPFYGPFGDIQDAEACEQQFRNAFLMGCVGAWSLHPN
QIAIAKRVFSPDPDEVQFAKRILEAMPDGTGVAMIDGKMQDDATWKQAKVIVDLAKKVGA
KDPDLAKAYGF
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcatggatttgcgatcgaagcatcgctagactgcgcgcaaatcgcccttatccc
cagtggactgtcatgaaactgccatcgttcttttacaaaccgctcgccatcggtgccccg
gccccctaccgggagctgcccgtcgccctcgaacggatgatccatttcttccccggacac
aatgagaagctccgttcgcgcctcggcgagataatcccgcaggtcgatgtgctgctcggc
aacctcgaggatgcgattccggcggacgcgaaggaggcggcgcggaagggtgtgatcgag
gtcggcaagagccatgatttcggatcgaccggtttctgggtccgcatcaatccgctgaac
agtccctggatgctggacgatgtgacggagctcgtggccgagatcggcgacaagctcgac
gtcatcatgctgcccaaggtggaaggcgcatgggatatccactatctggaccagctgctc
gcacagctcgaggcgaagcatgggctgaagaagccgcttctcattcacgcgatcctcgaa
accgcacaaggcgtgaagaacgtggaggagatcgcctgcgcctccccccgcatgcatggc
atgagcctcggcccggcggacctcgcggcatcgcgaaagatgaagacgacgcgcgtcggc
ggcggacatcctttctaccgggtgctcgaagacccgaaggaagacggcagcccccgcatc
gccgcccagcaggacctctggcactacacatttgccaaaatggtggacgcctgcgtcgcg
aacgacatccgtcccttttacggccccttcggcgacattcaggacgcggaagcctgcgag
cagcagttccgcaatgccttcctcatgggctgcgtcggcgcatggtcgctgcatccgaac
cagatcgcgatcgccaagcgcgtcttcagcccggacccggacgaagtgcaatttgcaaaa
cgcatcctggaggccatgcccgacggcaccggcgttgcgatgatcgacggcaagatgcag
gacgacgccacctggaaacaggcaaaggtgatcgtcgatctcgcaaaaaaggtcggggcc
aaagaccccgaccttgcaaaagcctacggcttctga

DBGET integrated database retrieval system