KEGG   Parvibaculum lavamentivorans: Plav_3139Help
Entry
Plav_3139         CDS       T00580                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00010  Glycolysis / Gluconeogenesis
pla00020  Citrate cycle (TCA cycle)
pla00620  Pyruvate metabolism
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
pla01120  Microbial metabolism in diverse environments
pla01130  Biosynthesis of antibiotics
pla01200  Carbon metabolism
Module
pla_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Plav_3139
   00020 Citrate cycle (TCA cycle)
    Plav_3139
   00620 Pyruvate metabolism
    Plav_3139
Enzymes [BR:pla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Plav_3139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N RnfC_N HlyD_3 Peptidase_M23 DUF2118
Motif
Other DBs
NCBI-ProteinID: ABS64746
UniProt: A7HXW3
Position
complement(3352277..3353569)
Genome map
AA seq 430 aa AA seqDB search
MPTNILMPALSPTMEEGTLAKWHVKEGDEVKSGDVIAEIETDKATMEVEAVDEGRIGKLL
VAEGTEGVAVNKPIAILLEEGEEAADIDNAPPPKKDEPKTSAKPEAKEVEKPRSSATPSS
DGNARPTQATGTGHRVFASPLARRIAEQQGIDLSAISGSGPNGRIVKADLEGAAKAAPKK
QAAGAVAQGAAQSIDPRAYYAEGTFEEVSLDGMRRTIARRLTQSMQEIPHFYLTIDCELD
ELLKARKKLNDEAGEGVKLSVNDFLIRAAALALIKVPDANVSFAGNALLKHKSADIGIAV
ALEGGLITPIIRNADKKGLAEISNEAKELAERARNKKLKPNEYEGGSFSISNLGMFGIKH
FTAVINPPQAAILAVGKGEERPVVRNGKVEVATIMTVTMSCDHRAIDGALGARFLEAFRS
FVEYPARMLL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgccgacgaacatactgatgcccgcgctctcgccgaccatggaagagggaacgcttgcc
aagtggcatgtgaaggaaggcgatgaggtaaaatccggtgacgtgattgccgagatcgaa
accgacaaggcgacgatggaagtggaagcggtcgacgaaggccgtatcggaaagctgctc
gtagccgaaggcacggaaggtgtcgccgtcaacaagcccattgccattttgctggaagag
ggcgaagaggcagcggacatcgacaatgcgccgccaccgaaaaaggatgaaccaaagaca
tccgcgaaaccggaagcaaaagaagtcgagaagccacggtccagcgcaaccccgtcttcg
gatggtaacgctcgtcccacgcaggcgaccggcacggggcatcgcgtttttgcgtccccg
cttgcgcggcgcattgcggaacagcaaggcatcgatctttccgccatcagcggctctggt
cccaacggccgcatcgtaaaggcggacctggaaggtgcggcgaaggccgcgccgaagaag
caagcggcgggcgctgttgcccagggtgcggcacagagcatcgacccccgtgcatattat
gcggaaggaacctttgaagaggtttcactcgatggaatgcggcggacaatcgcccgccgc
ctcacgcagtcaatgcaggagataccgcatttctatctgacgatagactgcgagctggac
gagctgctgaaagcgcgcaagaagttgaacgacgaagcaggcgagggcgtcaagctctcg
gtaaacgacttcctgatccgcgctgccgcgctcgccctcatcaaggtgccggatgcgaat
gtgagctttgccggcaacgctctcctgaagcacaagagcgccgacataggtatcgcggtc
gctcttgaaggcggcctcatcacgccgattattcgcaacgcggacaaaaaaggcctcgcc
gaaatatcgaatgaggccaaagaacttgccgagcgagcgcgtaacaaaaagctgaagccg
aacgaatacgaaggcggctccttttcaatttccaatctcggcatgttcggcatcaagcat
ttcaccgctgtcatcaatccgccccaagccgccatcctcgcggtcggcaagggcgaggag
cgcccggtggtgagaaatggcaaggttgaagtcgccacaataatgacggtcaccatgtcc
tgcgaccaccgcgccatcgatggcgcactcggcgcacgcttcctcgaagcgttcagatca
ttcgtggaatacccggcaaggatgctgctctga

DBGET integrated database retrieval system