KEGG   Parvibaculum lavamentivorans: Plav_3240Help
Entry
Plav_3240         CDS       T00580                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla00071  Fatty acid degradation
pla00280  Valine, leucine and isoleucine degradation
pla00310  Lysine degradation
pla00362  Benzoate degradation
pla00380  Tryptophan metabolism
pla00620  Pyruvate metabolism
pla00630  Glyoxylate and dicarboxylate metabolism
pla00640  Propanoate metabolism
pla00650  Butanoate metabolism
pla00900  Terpenoid backbone biosynthesis
pla01100  Metabolic pathways
pla01110  Biosynthesis of secondary metabolites
pla01120  Microbial metabolism in diverse environments
pla01130  Biosynthesis of antibiotics
pla01200  Carbon metabolism
pla01212  Fatty acid metabolism
pla02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Plav_3240
   00630 Glyoxylate and dicarboxylate metabolism
    Plav_3240
   00640 Propanoate metabolism
    Plav_3240
   00650 Butanoate metabolism
    Plav_3240
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Plav_3240
   00072 Synthesis and degradation of ketone bodies
    Plav_3240
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Plav_3240
   00310 Lysine degradation
    Plav_3240
   00380 Tryptophan metabolism
    Plav_3240
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Plav_3240
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Plav_3240
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Plav_3240
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pla04147]
    Plav_3240
Enzymes [BR:pla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Plav_3240
Exosome [BR:pla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Plav_3240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C DUF2611
Motif
Other DBs
NCBI-ProteinID: ABS64845
UniProt: A7HY62
Position
complement(3458985..3460538)
Genome map
AA seq 517 aa AA seqDB search
MSDIKLDDRMPVLVGCGQLVQKEKDVEKAKSPMHLMEDAARAAASDAGLGDKLWPIVDNV
TVVRFITDSPDSGKLPFGRYPNAPKTLSNMLGANPARNCYGPTGGNTPQMLVNHTAELIA
NGETEVALVAGSECFGTMMRALGQGKMLPWNDDPGGERIDIGVEKAGVTDVEKRHKLQFP
VNIYPMFENAIRGAAGRSVKDHQLAIGKLMAPFTEVAAKHPQAWFPVARTAEEIATPTDD
NRYVGFPYTKYMNAIMQVDQAAAVVMMSVKKARELGIPQSKWVFLHGCADANDLWYPTER
VNYHSSPAIRMMGKKAFAMSGWNIGDIDYFDLYSCFPSAVQIGRQELGIAEDDPRSLTVT
GGLPYFGGAGNNYVMHSIATMMDKLRAKPGSKGLCTSNGWYVTKHGLGLYSTTPREGKWE
REKPAAYQAEIDAEKHPKVDEKPSGKARIETYTVVHGRGGAEFAIVFGRLADTDARFVAH
TPNDPATLADMVKRDQLGRTGTVASPADGSVNIFTPE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacatcaagctcgacgaccgcatgccggtcctggtgggctgcggccagctcgtc
cagaaggaaaaggatgtcgagaaggcgaagtcgcccatgcatctgatggaagatgccgcc
cgcgccgctgcgtcggatgccggtcttggcgacaaactctggccgatcgtcgacaatgtc
accgtcgtccgcttcatcaccgacagcccggattccggcaagcttcctttcggccgctac
ccgaatgcgccgaaaacactctccaacatgctgggcgcaaatccagcaaggaattgctac
ggccccaccggcggcaacacgccgcaaatgctggtgaaccacaccgcggaattgattgcc
aacggcgaaacggaagtcgctctcgtcgcgggctcggaatgtttcggcaccatgatgcgc
gcgctggggcagggcaagatgctcccctggaacgacgatccgggtggcgagcgcatcgac
atcggcgtcgagaaggccggcgtcacggatgtcgaaaagcgccacaagctgcaattcccc
gtgaacatctacccgatgttcgaaaatgccattcgcggtgcggccggccgcagcgtgaag
gatcaccagctcgccatcggcaaactcatggcccccttcaccgaagtagcggcgaagcac
ccgcaggcctggtttcccgtcgcccgcactgccgaggaaatcgcgacgccgaccgacgac
aaccgctatgtgggttttccgtacacgaagtatatgaacgccatcatgcaggtcgaccag
gccgccgccgtggtgatgatgtcggtgaagaaggcgcgagagctcggcatcccgcaatcg
aaatgggtcttcctccacggttgcgccgatgcgaacgatctctggtatccgaccgagcgc
gtgaactatcactcctcgcccgctatccggatgatgggcaaaaaggccttcgccatgtcc
ggttggaatatcggcgatatcgattatttcgacctctattcctgcttcccttccgccgtg
cagatcggccgtcaggaactcggtatcgcggaagacgacccgcgttcgctcaccgtcacc
ggaggcctcccttatttcggcggcgccggcaacaactacgtcatgcactccatcgccacc
atgatggacaagctccgcgcgaagccgggctcgaaaggcctctgcacctccaatggctgg
tacgtcacgaaacacggcctgggcctctattccacgaccccgcgcgagggcaaatgggag
cgtgaaaagcccgctgcctaccaggccgaaatagatgccgaaaagcacccgaaagtggac
gaaaagcccagcggcaaggcccggatcgagacctatacggttgtccatggccgcggcggc
gcggagttcgctatcgtcttcggccgcctcgctgacacggatgcgcgcttcgtcgcccac
acgccgaacgacccggcaacgctggcggatatggtaaaacgggaccagctgggccggacg
ggaacagttgccagcccggccgatggaagtgttaacatatttacgccggagtga

DBGET integrated database retrieval system