KEGG   Parvibaculum lavamentivorans: Plav_3415
Entry
Plav_3415         CDS       T00580                                 
Name
(GenBank) conserved hypothetical protein
Organism
pla  Parvibaculum lavamentivorans
SSDB
Motif
Pfam: DUF4400 DUF2933
Other DBs
NCBI-ProteinID: ABS65018
UniProt: A7HYN5
Position
3654215..3654964
AA seq 249 aa
MKDAASTAQREQNQRQGLIVGTITLPFRLLGVLIGSLLFSIVVECVGMHLFWKEQGWRHS
QQMLQYELGHLSNHFTRSVVVQEPGRTAHELVDTGYEWVFVRSGLLERMSQTAERARTPS
QGQTRNFRYFISQVYVWAESYLIAAAFTTLTFLVRLLVLALTLPLIFTAAFVGLIDGLVR
RDVRRFGAGRESGFIYHRAKASLMPLAVLPWITYLALPISVHPLLILLPSAALLGLAVSL
TAGSFKKYL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaaagatgccgcctcgaccgcgcagcgggagcagaaccagcgccaaggtctgatcgtc
ggcaccatcaccttgccgttccggctgctcggggtgctgatcggctcgctgctgttctcc
atcgtggtggagtgcgtcggcatgcacctgttctggaaggaacagggctggcgccattct
cagcagatgttgcagtacgaactggggcacctgtccaatcacttcacgcgcagcgtggtc
gtgcaggagccggggcgcacggcgcacgagctggtggataccggctacgaatgggtgttc
gtgcgctcggggctgctggaacgcatgagtcagaccgctgagcgcgcccgcacgcccagc
cagggacagacgcggaactttcggtacttcatcagccaggtctatgtctgggccgagagc
tacctgattgccgccgcgttcacgacgttgacctttcttgtgcggctgttggttctggcg
ctcacgctgcccttgatcttcacggcggcattcgtcgggctgatcgacggcttggttcgg
cgtgacgtgcgtcgatttggcgccgggcgtgaatcgggcttcatctaccatcgtgcgaaa
gccagcctgatgccgctggccgtgctgccgtggatcacctacctggcactgccgatctcg
gtgcatccgctgctgatcctcctgccgagtgccgccttgctgggcttggccgtgagcctg
accgccggcagcttcaaaaagtatctctag

DBGET integrated database retrieval system