KEGG   Parvibaculum lavamentivorans: Plav_3423Help
Entry
Plav_3423         CDS       T00580                                 

Definition
(GenBank) conserved hypothetical protein; putative signal peptide
Organism
pla  Parvibaculum lavamentivorans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ABS65026
UniProt: A7HYP3
Position
3659463..3659912
Genome map
AA seq 149 aa AA seqDB search
MLSNLTDLTRGLALAVAVAVLGGCATSKEKLLPHGSSTMMDIWQQEAGDGGGGAGQVARR
QLLDARQSLRRPLTEADVQAAPSEQMRYTRTARNEVYRQFQRLPNPDLVMYVFPHLAGTD
PIPVPGYTTVFPLYQRTQYAMPGERVEDY
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgctctcgaacttgactgacttgacccgtggccttgcgctggccgttgccgttgcggtg
ctcggcggctgcgccaccagcaaggaaaagctgctgccccacggtagcagcacgatgatg
gacatttggcagcaggaagccggcgacggtggcggcggtgctggccaggtagcgcgcagg
caattgctcgatgcgcgtcaaagcctgcgtcggccgctgaccgaagcggacgtgcaggcc
gcaccttctgagcagatgcgctacacgcgcacggcgcgcaacgaagtctatcgccaattt
cagcgcctgccgaatcccgaccttgtgatgtatgtgttcccccacctggcgggcaccgac
cccatacctgtgccgggctacacgaccgttttccccctgtaccagcgtacccagtacgcc
atgccgggcgagcgcgtggaggattattga

DBGET integrated database retrieval system