KEGG   Parvibaculum lavamentivorans: Plav_3424
Entry
Plav_3424         CDS       T00580                                 
Name
(GenBank) conserved hypothetical protein
Organism
pla  Parvibaculum lavamentivorans
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 FtsK_SpoIIIE AAA_10 TrwB_AAD_bind T2SSE AAA_16 ATPase_2 AAA_7 DUF87 AIG1 DUF4913
Other DBs
NCBI-ProteinID: ABS65027
UniProt: A7HYP4
Position
3659912..3662782
AA seq 956 aa
MRWKLSWPKLAASSAGDEEQPDGWKRHVEALRQAGIPEPGSAVRGRRSATVADEQALYDV
APSFVELLPWVEFLPESKAMLLEDGQSVAAFYELVPLGTEGREPGWLAHARDALENALQD
SFDELDEHPWVLQLYAQDEASFDQYMQTLRDYVQPRARDTAFTEFYLRFFGHHLRAVAKP
GGLFEDTVVTRLRWRGQSRRVRMVVYRRSSGQASRRGQTPEQMLNIVCDRLCGGLANAGI
QARRMVATDVHDWLLRWFNPNPALLGPAVEDRERFYALARYPDETEDGEIELASGRDFSQ
RLFFGQPRSDVARGTWTFDGMPHRVLITDRLRMPPGAGHLTGETRKGDAINTLFDQMPED
TLMCLTMVATPQDVLESDLNHLAKKAVGETLASEQTLKDVHEARSLIGSAHKLYRGTLAF
YLRGRDEAELNRRGLDLANVMLNAGLQPVREDDEVAPLNSYLRWLPCCYNPSQDRRKWYT
QLMFAQHAANLSPVWGRAQGTGHPGITMFNRGGGPITFDPLNRLDRQMNAHLFLFGPTGS
GKSATLNNLLNQVTAIYRPRLFIVEAGNSFGLFSEFARRLGLTVNRVKLAPGSGVTLAPF
ADARRLIETPSDVQTLDADALDEELPPDASAMEPDEQRDVLGELEITARLMITGGEDKEE
ARMTRADRSLIRQCILDAAERCVAKRRTVLTRDVRDALRARGNDSTLPEMRRVRLLEMAD
AMDMFCQGTDGEMFDRDGSPWPEADITLVDLATYAREGYNAQLSIAYISLISTVNNIAER
DQYLGRPIVNVTDEGHIITKNPLLAPYVVKITKMWRKLGAWFWLATQNIDDLPRAAEPML
NMIEWWICLSMPPDEVEKIARFRELSPAQKALMLSARKEAGKFTEGVILSKSMEVLFRAV
PPSLYLALAQTEPEEKAERYQLMQQYGITELEAAFKVAENIDQARGIESPALDLPQ
NT seq 2871 nt   +upstreamnt  +downstreamnt
atgcgctggaaactctcttggccgaagctggccgcatccagtgctggcgatgaagagcaa
ccggacggctggaagcgccatgttgaggccttgcgccaggccggtattcccgaacccggc
tcggcggtccgcgggcgcaggtcggcaacggtggccgacgagcaggcgctgtacgacgtc
gcgccttcgttcgtggaactgctgccttgggtggagttcctgcccgagtcgaaggccatg
ctgctggaggacgggcaatcggtcgcggccttctacgagttggtgccgctgggcaccgag
ggccgggaacccggctggctcgcacatgcccgggatgccctggagaatgcgctgcaagac
agcttcgatgaattggacgagcacccctgggtactccagctctacgcccaggacgaggcc
agcttcgaccagtacatgcagaccctgcgcgactacgtgcagccgcgcgcacgcgataca
gctttcaccgagttctacctgcgctttttcggtcatcacctgcgcgcggtggccaagccg
ggtggcctgttcgaggacaccgtggtcacgcgcctgcgctggcgcggccaaagccggcgt
gtacggatggtggtctatcggcgttccagcggacaggcgagccgccgtggccagacgccg
gagcagatgctcaatatcgtctgcgatcgcctgtgtggtggcttggccaacgccggtatt
caggcccggcgtatggtcgcaaccgacgttcacgactggctgctgcggtggttcaacccc
aatcccgcgttgctcgggcctgcggtcgaggaccgcgagcgcttctatgcgttggcacgc
tatcccgatgagaccgaagacggcgagatcgaactggcgagcggacgggatttcagccaa
cggttgttctttgggcaaccgcgctccgacgtagcgcgcggtacctggaccttcgacggc
atgccgcaccgcgtgctgatcaccgaccggctacggatgccacccggcgccgggcatctg
accggagagacccgcaagggcgatgcgatcaacacgctgttcgaccagatgcccgaagac
accttgatgtgcctgacgatggtcgccacaccgcaggatgtcctcgaatcggatttgaat
cacctggcgaagaaggccgtgggcgaaaccctggcatccgagcagacgctcaaggatgtg
cacgaggcccgttcgctcatcggcagcgcgcacaagctctaccggggcacgctggcgttc
tacctgcgcgggcgtgacgaagccgagctgaaccgtcgcgggctggatctggcgaacgtg
atgctcaacgccggcttgcagccggtgcgcgaggacgacgaggtggcgccgctcaacagc
tacctgcgctggctgccgtgctgctacaaccccagccaagaccggcgcaagtggtacacg
caactcatgttcgcccagcacgcggcgaatctgtcgccggtatggggccgtgctcagggc
accgggcaccccggcatcacgatgttcaaccgcggcggcggcccgatcactttcgacccg
ctcaaccgcctggaccgacagatgaatgcccatctgttcctgttcggcccaaccggctcg
ggcaaaagcgccacgctcaacaacctgctgaaccaggtcacggccatctaccggccgcgg
ctcttcatcgtggaggctggcaacagcttcggtttgttcagcgaatttgccaggcgtttg
ggtctgacggtcaaccgcgtgaagctggcccctggctcgggcgtgaccctggcgccgttt
gccgatgcgcgccggctgatcgagacacccagcgacgtgcaaacgctcgatgccgatgcg
ctggacgaagagctgccacccgatgcctcggccatggagccggacgagcaacgcgacgta
ctgggcgagttggagatcaccgcgcggttgatgatcacaggtggggaagacaaggaagaa
gcccgcatgacgcgggccgaccgctcgctgatccgccagtgcattctggatgctgccgag
cgctgcgtggccaagaggcgcacggtgctcacgcgtgatgtgcgtgatgcgttgcgcgcg
cggggcaacgacagcacgctgccagagatgcggcgcgtgcggctgctggagatggcggac
gcaatggacatgttctgccagggcacggatggcgagatgttcgatcgggacggttcccct
tggcccgaggccgacatcactctggtggatctcgcgacctatgctcgcgagggctacaac
gcgcagctctccatcgcgtacatcagcctgatcagcacggtgaacaacatcgccgagcgc
gaccagtatctgggccgaccgatcgtcaatgtgaccgacgaaggccacatcatcaccaag
aacccgttgctcgcgccctacgtcgtgaagatcacgaagatgtggcgcaagttgggcgcg
tggttctggctcgcgacgcagaacattgacgatctgccccgtgccgcagaacccatgctc
aacatgatcgagtggtggatctgcctgtcgatgccgccggacgaggtggagaagatcgcg
cgctttcgcgaactctcgcccgcgcagaaggcgttgatgctttccgcacgcaaggaagca
gggaaattcaccgaaggcgtgatcctgtcgaagtcgatggaggtgctgtttcgggccgta
ccgccaagcctctacctcgcactcgcgcagaccgaacccgaggagaaggccgaacgctac
cagctcatgcagcagtacggcatcaccgaactggaggcggccttcaaggtggccgagaac
atcgaccaggcacgcggcatcgagtcgccggccctggacctgccgcaatag

DBGET integrated database retrieval system