KEGG   Parvibaculum lavamentivorans: Plav_3542
Entry
Plav_3542         CDS       T00580                                 
Name
(GenBank) Conjugal transfer protein TrbC
  KO
K20528  type IV secretion system protein TrbC
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pla00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Plav_3542
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pla02044]
    Plav_3542
Secretion system [BR:pla02044]
 Type IV secretion system
  Trb secretion system protein
   Plav_3542
SSDB
Motif
Pfam: TrbC ETRAMP
Other DBs
NCBI-ProteinID: ABS65140
UniProt: A7HSD1
Position
3786650..3786982
AA seq 110 aa
MIRTTMRVRRYAATAAAFIYINLVLVPAAHASGSSMPWEAPLQKILESIEGPVAKIVAVI
IIIATGLALAFGDTSGGFRKLIQIVFGLSIAFAASSFFLSFFSFGGGALI
NT seq 333 nt   +upstreamnt  +downstreamnt
atgatccgcaccaccatgcgcgttcgccgctatgccgcgacggccgccgccttcatctac
atcaatctcgtcctcgttcccgccgcccatgcctccggctcgtccatgccgtgggaagca
ccgctccagaaaattctcgaatccatcgaagggccggtcgccaagatcgtcgccgtcatc
atcatcatcgccaccggcctggcgctggcgttcggtgacacgtccggcggcttccggaag
ctgatccagatcgtcttcggtctcagcatcgcgtttgcggcgtcgagcttcttcctgtcg
ttcttctcattcggcggcggggcgctcatctga

DBGET integrated database retrieval system