KEGG   Parvibaculum lavamentivorans: Plav_3544
Entry
Plav_3544         CDS       T00580                                 
Name
(GenBank) AAA ATPase
  KO
K20530  type IV secretion system protein TrbE [EC:7.4.2.8]
Organism
pla  Parvibaculum lavamentivorans
Pathway
pla02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pla00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Plav_3544
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pla02044]
    Plav_3544
Enzymes [BR:pla01000]
 7. Translocases
  7.4  Catalysing the translocation of amino acids and peptides
   7.4.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.4.2.8  protein-secreting ATPase
     Plav_3544
Secretion system [BR:pla02044]
 Type IV secretion system
  Trb secretion system protein
   Plav_3544
SSDB
Motif
Pfam: CagE_TrbE_VirB P-loop_TraG AAA_10 AAA_22 AAA_29 HerA_C ABC_tran FtsK_SpoIIIE TraG-D_C AAA_16
Other DBs
NCBI-ProteinID: ABS65142
UniProt: A7HSC9
Position
3787278..3789728
AA seq 816 aa
MMNLAEYRRTATRLADYLPWAALVAEGVVLNKDGSFQRTARFRGPDLDSAVAAELVAVAG
RLNNAFRRLGSGWAIFVEAQRHEASIYPADLFPDAAAALLDAERKADFEEAGAHYVSGYY
LTITYLPPAEDAARTEAWLYEGRERAGIDPKEILNTFVDRTDRVLALLDGFMPECQWLDS
SETLTYLHSTVSTKRHRVRVPETPVYLDALLADQPLTGGLEPRLGTAHLRVLTIVGFPTA
TTPGILDDLNRLAFPYRWSTRAILLDKTDATKLLTKIRRQWFAKRKSIAAILKEVLTNEA
SALVDTDASNKAADADLALQELGADYAGQSYVTATIAVWDNDPRVADEKLRLAEKVIQGR
DFTAMTETINAVDAWLGSLPGHVYANVRQPPISTLNLAHMIPLSAVWAGPERDEHLGSSP
LLFGKTEGSTPFRFSLHVGDVGHTLVVGPTGAGKSVLLAIMALQFRRYAGAQVFAFDFGG
SIRTAALAMGGDWHDLGGDLTEGVDSSVSLQPLARIHDTPERAWAADWIVAILIREGIAI
TPEVKEHLWSALTSLASAPVEERTITGLTVLLQSNDLKQALRPYCVGGPYGRLLDAEAEH
LGSASVQAFEIEGLVGTGAAPAVLAYLFHRIGDRLDGSPTLLIIDEGWLALDDDAFSGQL
REWLKTLRKKNASVIFATQSLSDIDNSNIAPAIIESCPTRLLLPNERAIEPQITEIYRRF
GLNDRQIEILARATPKRDYYCQSRRGNRLFELGLSEVGLALAATSSKTDQSEIARTVAEH
GREGFLAAWLRLRGAEWAADLIPDLTNLTPQQSEKE
NT seq 2451 nt   +upstreamnt  +downstreamnt
atgatgaatcttgccgaatatcgccgcaccgcaacccgcctcgctgactatctgccctgg
gccgcgctcgtcgccgagggcgtcgtgctcaacaaggacggcagctttcagcgcacggcg
cggttccgcggccctgatctggactccgcggtcgccgccgaactggtcgccgtcgccggg
cggctcaacaacgcattccgtcgtctcggatcgggttgggccatcttcgtcgaggcgcag
cggcacgaggcgtcgatctatccagcggacctgtttcccgacgccgccgcagcgcttctc
gatgccgagcgcaaagccgatttcgaggaggccggcgcgcattacgtctccggctactat
ctcaccatcacctatctgccgccggccgaggatgccgcgcgcaccgaagcctggctctat
gagggccgcgaacgtgctggcatcgatccgaaggaaatcctgaacacctttgtcgaccgc
accgatcgcgtgctggcgctgctcgacggcttcatgccggaatgccagtggctcgatagc
agcgagacgctgacatatctccattcgaccgtctcgaccaaacggcaccgcgtccgtgtg
cccgaaacgccggtctatctcgacgcgctgctcgccgaccaaccgctcaccggcggcctg
gagccgcgtctcggaaccgcgcatctgcgcgttctcaccattgtcggtttcccgaccgcg
accacgcccggcatcctcgacgatctcaatcggctcgcctttccctatcgctggtcgacg
cgcgccatcctgctcgacaagaccgacgcgaccaagctgctgaccaaaatccgccgccaa
tggttcgcgaagcgcaaaagcatcgccgcgatcctgaaagaggtgctgaccaacgaggcg
tccgcgctggtcgataccgacgcctcgaacaaggcggcggacgccgatctcgccctccag
gaactcggcgctgactacgccggccaatcctatgtcaccgcgacgatcgcggtatgggac
aacgatccccgagttgccgacgagaagcttcgcctcgccgagaaagtcatccagggccgc
gacttcacggccatgactgaaacgatcaatgccgtcgatgcctggctgggctcattgccg
gggcatgtttacgccaacgtgcgccagcccccgatttcgacgctgaatctcgcccacatg
atcccgctctcggcggtgtgggcggggccggaacgggacgagcatttgggtagctccccc
ttgctgttcggcaagaccgaaggctcgaccccgttccggttttctctccatgtcggcgac
gtcggtcacacgctcgtcgtcggcccgaccggcgccggcaaatcggtgctcctcgccatc
atggccttgcagttccggcgctatgccggtgcccaggtcttcgccttcgacttcggcggt
tcgatccgcaccgccgcgctcgccatgggcggtgattggcacgatctcggcggcgatctc
accgagggcgtggactcctcggtctcgctgcaaccgctcgcgcgcattcacgacacgccc
gaacgcgcctgggcggccgactggatcgtcgccatcctgatccgcgagggcatcgcaatc
acccccgaggtgaaggagcacctctggtcggcgctgacctcgctggcgtcggcgccggtc
gaggaacgcacgatcaccggcctcacggtgttgctccaatcgaacgacctgaagcaggct
ctgcgaccgtattgcgtgggcggcccctatgggcggctactcgacgccgaggccgaacat
ctcggctcggcatcggtgcaggcgttcgagatcgagggactggtcgggactggcgcggca
cccgccgtcctcgcctatctcttccatcgcatcggcgaccgtctcgacggctcgccgacg
ctgctcatcatcgacgagggctggctcgcactcgatgacgatgccttctccgggcaattg
cgcgaatggctgaagacgctgcgcaagaaaaacgccagcgtcatcttcgccacgcagtcg
ctgtccgacatcgacaacagcaacatcgccccggccatcatcgagagctgcccgacaagg
ctgctcctgccgaacgaacgcgcgatcgagccgcagatcacggagatctatcggcgcttc
ggtctcaacgaccgccagatcgaaatcctcgcgcgggccacgcccaagcgcgactattac
tgccagtcgcggcgcggcaatcgcctgttcgagctgggcctctccgaagtcggtctcgcg
ctcgccgccacctcctccaagaccgaccagtccgagatcgcgcgcaccgtcgccgagcat
ggccgcgagggctttctcgccgcctggctgcgcctgcgcggcgccgagtgggccgcagac
ctcatccctgacctcacgaacctcaccccccagcagtccgagaaggagtaa

DBGET integrated database retrieval system