KEGG   Plantactinospora sp. BC1: C6361_00955Help
Entry
C6361_00955       CDS       T05377                                 

Definition
(GenBank) fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
plab  Plantactinospora sp. BC1
Pathway
plab00051  Fructose and mannose metabolism
plab01100  Metabolic pathways
plab01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:plab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C6361_00955
Enzymes [BR:plab01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     C6361_00955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: AVT28302
Position
236128..237447
Genome map
AA seq 439 aa AA seqDB search
MIFTGLDIADIRFPTSRELDGSDAMNPDPDYSAAYVVIRTDAGDGHEGHGFAFTIGRGND
VQAAAIASLRPYLVGRSVEAVLADLGGLWRELVHDSQLRWLGPEKGVMHMAVAAVVNALW
DLRAKRAGLPLWRLLAGMSPEELVDLVDFRYLSDALTRDEALAILRAGRTGRAEREEHLL
RDGFPAYTTSPGWLGYDDEKLRRLCKEALADGFTQIKLKVGADLHDDIRRMGIARQTCGP
DIRIAVDANQRWDVPQAISWVRELAPFDPYWIEEPTSPDDVVGHATIARELAPVRIATGE
HVANRVVFKQLLQLGAISYLQIDASRVAGVNENIAILLLAAKFGVPVCPHAGGVGLCELV
QHLSMFDYVAVAGSMQDRVIEYVDHLHEHFVDPVVIRRGRYVAPTAPGFSATMRPETLTE
YAYPDGPVWAAPPAEVAVP
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgatcttcaccggactcgacatcgccgacatccgcttcccgacctcccgggaactcgac
ggctcggacgcgatgaaccccgaccccgactactcggccgcgtacgtggtgatccgtacc
gacgccggggacggacacgaggggcacggcttcgccttcaccatcgggcgcggcaacgac
gtgcaggcggcggcgatcgcgtcgctgcggccgtacctggtcggccgctcggtcgaggcg
gtcctggccgacctcggcggcctctggcgggaactcgtgcacgactcccagcttcgctgg
ctcggcccggagaagggcgtcatgcacatggcggtcgccgccgtggtcaacgcgctctgg
gacctgcgggccaagcgggccgggctgccgctctggcgactgctggccgggatgagcccg
gaggaacttgtcgacctggtcgacttccgctatctcagcgacgcgctgacccgcgacgag
gcgctggcgatcctccgggccggccgcaccggccgggccgagcgggaggaacacctgctg
cgcgacggcttccccgcctacaccacctcgcccggctggctcggctacgacgacgagaag
ctgcgccggctctgcaaggaggcgctcgccgacggcttcacccagatcaagctgaaggtc
ggcgccgacctgcacgacgacatccgccggatggggatcgcccggcagacctgcgggccg
gacatccggatcgccgtcgacgccaaccagcgctgggacgtaccgcaggcgatctcctgg
gtacgcgagctggcgcccttcgacccgtactggatcgaggagccgaccagcccggacgac
gtcgtcgggcacgccaccatcgcccgggaactcgccccggtccggatcgccaccggcgag
cacgtggcgaaccgggtcgtcttcaagcaactgcttcagctcggcgcgatctcctacctc
cagatcgacgccagccgggtcgccggggtcaacgagaacatcgcgatcctgctgctggcg
gcgaagttcggcgtgccggtctgcccgcacgcgggcggggtcgggctctgcgaactcgtc
cagcacctgtcgatgttcgactacgtcgccgtcgccggctcgatgcaggaccgggtcatc
gagtacgtcgaccacctgcacgagcacttcgtcgacccggtggtgatccgccggggccgg
tacgtggcaccgaccgcccccggcttcagcgccacgatgcgcccggagacgctgaccgag
tacgcctatccggacggcccggtctgggccgccccgccggccgaggtggcggtgccgtga

DBGET integrated database retrieval system