KEGG   Plantactinospora sp. BC1: C6361_04220Help
Entry
C6361_04220       CDS       T05377                                 

Definition
(GenBank) ornithine cyclodeaminase
  KO
K21721  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase [EC:1.5.1.51]
Organism
plab  Plantactinospora sp. BC1
Pathway
plab00998  Biosynthesis of secondary metabolites - other antibiotics
plab00999  Biosynthesis of secondary metabolites - unclassified
plab01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plab00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of secondary metabolites - other antibiotics
    C6361_04220
   00999 Biosynthesis of secondary metabolites - unclassified
    C6361_04220
Enzymes [BR:plab01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.51  N-[(2S)-2-amino-2-carboxyethyl]-L-glutamate dehydrogenase
     C6361_04220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OCD_Mu_crystall
Motif
Other DBs
NCBI-ProteinID: AVT28834
Position
complement(994605..995666)
Genome map
AA seq 353 aa AA seqDB search
MGGFVTMETLRFLDRAAVSACLREIDPVEVVADLVRAHTLGRTTMPAEGYLSWTNGEGAY
SRAIAMLGAVPAAGGGTAYGMKLINAAVSNPKHGRERAGGLSFVFDPETARPVLVAEAAR
LSAVRTAAYTLLSLRELGPVEPDAVTFLGAGVLASTHLELMVAGFPTLRRVYVFDVVPDR
AEAFADRARAAYPRLAVEVAPDARRAVGVAPVLVTVTTSDTPYIPPSWLPSGGFVAHVSL
DDLTEEAILGAEAIYVDDADLIRENPRRIMGRLMQDDKLLWTDEGGSAGTASTGRPLDGS
LGQVLLGHRPARRPGTGYVVSNPFGMAVLDVGLVDAVATVAARTDAGVRLELF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgggaggcttcgtgaccatggagacgctgcgctttctcgaccgggctgcggtgagcgcg
tgcctgcgcgagatcgatcccgtggaggtcgtcgccgacctggtccgggcacacacgctg
ggccgcaccacgatgccggccgagggctacctgagctggacgaacggggagggcgcctac
agccgggcgatcgccatgctcggcgcggtcccggcggcgggcggcgggacggcgtacggg
atgaagctcatcaacgccgccgtgagcaatccgaaacacggccgtgaacgggccggtggg
ctcagtttcgtcttcgacccggagacggcacgaccggtgctggtcgccgaggcggcccgg
ctcagcgcggtgcgtacggccgcctacacgctgctcagtctgcgcgaactcggccccgtc
gagccggacgcggtcaccttcctcggtgccggcgtactcgccagcacccacctcgaactg
atggtcgccggcttccccacgctgcgccgggtgtacgtcttcgacgtcgtacccgaccgg
gccgaggcgttcgccgaccgggcccgtgccgcctatccgcggctcgcggtcgaggtggcg
ccggacgcgcgccgggcggtcggcgtggcacccgtcctggtcacggtgaccaccagcgac
acgccgtacatcccgccgtcgtggttgccctcgggcggcttcgtcgcacacgtctcactc
gacgacctcaccgaggaggcgatcctcggcgccgaggcgatctacgtggacgacgccgac
ctcatccgggagaacccgcgccggatcatgggccggctgatgcaggacgataagctactg
tggacggacgagggcggttccgccggcacggcgtcgaccggccgtcccctggacggcagc
ctcggccaggtcctgctcggccaccgacccgcccggcgccccggcaccggatacgtggtc
agcaatccgttcggcatggccgtcctggacgtcgggctggtcgacgcggtcgccaccgtg
gcggccagaaccgacgcgggtgtgcggctggagctgttctga

DBGET integrated database retrieval system