KEGG   Plantactinospora sp. BC1: C6361_19350Help
Entry
C6361_19350       CDS       T05377                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
plab  Plantactinospora sp. BC1
Pathway
plab00625  Chloroalkane and chloroalkene degradation
plab00680  Methane metabolism
plab01100  Metabolic pathways
plab01120  Microbial metabolism in diverse environments
plab01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plab00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    C6361_19350
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    C6361_19350
Enzymes [BR:plab01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     C6361_19350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_N_assoc ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C HI0933_like Pyr_redox_2 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: AVT31279
Position
complement(4443337..4444473)
Genome map
AA seq 378 aa AA seqDB search
MKAVVYHGPREVAVENVEDPRVQDPNDVVVQVTSSAICGSDLHMYEGRTGAEPGIVLGHE
NMGIVVDVGPGVVHVKRGDRVSMPFNVACGFCPNCLAGNTGYCLTANPGFAGAAYGYVNM
GPYRGGQAEYLRVPFADFNCLKLPPGNEHENDFAMLADIFPTGYHGVAMTELRPGETITV
MGGGPVGLMAAYSAMLIGAAKVFLVDRVPSRLRLAESIGAIPVDFGQGDPVEQIRDQTDG
DGTDKGVDAVGYQGTGAGGEEQPASVLNSLVEIVRATGRIGVVGLYVPHDPGAPDEHSRN
GELLFRVGKFFEKGLRIGSGQTNVKAYNRYLRDLIVAGRARPSFVVSKELPLDAAPEGYD
RFDRRDEGYSKVVLKPAA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagtggtctaccacgggccgcgcgaggtcgcggtggagaacgtcgaggacccc
cgggtccaggaccccaacgacgtggtcgtgcaggtgaccagcagcgcgatctgcggctcc
gacctgcacatgtacgaggggcgtaccggcgcggagccgggcatcgtcctcggacacgag
aacatgggcatcgtggtcgacgtcggccccggcgtggtgcacgtcaagcggggcgaccgg
gtgtcgatgccgttcaacgtcgcctgcgggttctgcccgaactgcctggccggtaacacc
ggctactgcctcaccgccaaccccggcttcgccggcgccgcctacgggtacgtcaacatg
ggtccgtaccggggcggccaggccgagtacctccgggtgccgttcgccgacttcaactgc
ctgaaactgccgcccggcaacgagcacgagaacgacttcgcgatgctcgccgacatcttc
cccaccggctaccacggggtggcgatgaccgagctgcgtcccggcgagaccatcacggtg
atgggtggcggcccggtcgggctgatggcggcgtactcggcgatgctgatcggtgcggcc
aaggtcttcctggtcgaccgggtgccctcccggctccgcctcgcggagtcgatcggcgcg
atcccggtcgacttcggccagggtgacccggtcgagcagatccgggaccagaccgacggc
gacggcaccgacaagggcgtcgacgcggtcggctaccagggcaccggagcaggcggcgag
gagcagccggcgtcggtgctgaacagcctggtcgagatcgtccgggccaccggccggatc
ggggtggtgggactctacgtaccgcacgaccccggggcacccgacgaacactcccgcaac
ggcgagctgctgttccgggtcggcaagttcttcgagaaggggctccggatcggcagcggg
cagaccaacgtcaaggcgtacaaccggtacctgcgggacctgatcgtcgccggacgggcc
cggccgagcttcgtggtcagcaaggagttgccgctcgacgcggcgccggagggctacgac
cggttcgaccggcgcgacgagggctactccaaggtggtgctcaagcccgccgcgtga

DBGET integrated database retrieval system