KEGG   Plantactinospora sp. BC1: C6361_26475Help
Entry
C6361_26475       CDS       T05377                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
plab  Plantactinospora sp. BC1
Pathway
plab03010  Ribosome
Brite
KEGG Orthology (KO) [BR:plab00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    C6361_26475
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:plab03011]
    C6361_26475
Ribosome [BR:plab03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    C6361_26475
  Bacteria
    C6361_26475
  Archaea
    C6361_26475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AVT32417
Position
complement(6040489..6040986)
Genome map
AA seq 165 aa AA seqDB search
MPVKGDAPVLPGARAVARHVRISPTKARRVVNLVRGLPAKEALTVLQFAPQAASEQVYKV
LASAIANAENNERLDPDALLVSEAFVDEGPTMKRFQPRAQGRAYRIRKRTCHITIVVEAV
APTAPAGRGAAKKAAPAKATKSTEPAATEPTTEGGQTQSKTEGAE
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgccagtaaagggcgacgctccggtgcttccgggcgcgcgggcggttgcgcgacacgtg
cgcatctcgccgaccaaggcgcgccgggtggtcaacctcgtccgcggtctgcccgcgaag
gaggcgctcacggtgctgcagttcgcgccgcaggcggcgagtgagcaggtttacaaggtg
ctcgcgagcgcgatcgccaacgcggagaacaacgagcggctggaccccgacgcgctgctc
gtcagcgaggcgttcgtggacgagggcccgacgatgaagcggttccagcctcgggcgcag
ggccgggcgtaccggatccgcaagcggacctgccacatcaccatcgtggtggaggccgtg
gcgccgacggccccggccgggcggggtgcggcgaagaaggccgctccggccaaggcgacc
aagtcgaccgagccggccgcgaccgagccgacgaccgagggcggccagacgcagagcaag
acggagggtgccgagtaa

DBGET integrated database retrieval system