KEGG   Plantactinospora sp. BC1: C6361_33340Help
Entry
C6361_33340       CDS       T05377                                 

Definition
(GenBank) cellobiohydrolase
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
plab  Plantactinospora sp. BC1
Pathway
plab00500  Starch and sucrose metabolism
plab01100  Metabolic pathways
plab02020  Two-component system
Brite
KEGG Orthology (KO) [BR:plab00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C6361_33340
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C6361_33340
Enzymes [BR:plab01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     C6361_33340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-ProteinID: AVT35015
Position
7600176..7601531
Genome map
AA seq 451 aa AA seqDB search
MRRSGRVPARGRTALAVLAVPVLLAGALGSAGPAGATKPPHLMVNPYAGARVYVNPEWSA
RAAAEPGGGAIAGQPTAVWLDRIAAIEGTDGAMGLRDHLDAAVAQRADLVQVTLYNLPSR
DCGRPLPQGELSIDELDRYRTEFVDPTVEILAAPHYAGLRIVVFVEPNSLPNLVVNTSPR
HTATWACDQVLARGTYPDGIGYALSRLGALPNVYPYLDISHHGELGWPEDSGPMTALLHQ
AATSAGSTVANVHGFVANTANYSPLHEEWFQADDVVNGYPVYQSRWVDWNPFVDEVPYAR
HMRELLVGAGFSARASLLVDTSRNGWGGPNRPTGPAPATGDLNEYVDRSRIDRRTHITNW
CNQAGSGLGERPAVDPEPGIDAYVWVKPPGESDGTGVSRDVGQPYEPMCDPNYNPPGGSF
RITGALPGGPPFRQWFPAHFRQLLANAWPPL
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgttccggacgcgtacccgcccggggccgtacggccctcgccgtcctcgccgta
cccgtcctgctcgccggggcgctcggcagcgccggtccggccggtgccaccaaaccgccg
cacctgatggtcaacccgtacgccggggcccgggtgtacgtgaatcccgagtggtccgcc
cgggccgccgccgagcccggtggcggcgcgatcgccggccagccgaccgccgtctggctg
gaccggatcgccgcgatcgagggcaccgacggagcgatggggctgcgcgaccacctggac
gccgccgtggcgcagcgggccgacctcgtccaggtgaccctctacaacctgccgtcccgg
gactgcggccggccgctgccgcagggcgaactctcgatcgacgaactcgaccggtaccgg
acggagttcgtcgatccgaccgtcgagatcctcgccgccccccactacgccgggctgcgg
atcgtcgtcttcgtcgagccgaactccctgcccaacctggtcgtcaacaccagccctcgg
cacaccgccacctgggcctgcgaccaggtgctggcccggggcacctatccggacgggatc
gggtacgccctgtcccggctcggcgccctgcccaacgtctacccgtacctggacatcagc
caccacggcgaactcggctggccggaggactccggcccgatgacggcgctgctgcaccag
gccgcgaccagcgcgggcagcacggtggcgaacgtgcacggcttcgtcgccaacaccgcc
aactactccccgctgcacgaggagtggttccaggccgacgatgtcgtcaacggctacccg
gtgtaccagtcgagatgggtcgactggaacccgttcgtcgacgaggtgccgtacgcccga
cacatgcgggaactgctggtcggggcgggcttctccgcgcgggcgagcctgctggtcgac
acctcgcgcaacggctggggcggcccgaaccggcccaccggaccggcgccggctaccggc
gacctgaacgagtacgtcgaccggagccggatcgaccggcgaacccacatcacgaactgg
tgcaaccaggctggctcgggcctcggcgagcggcccgccgtcgacccggagcccggcatc
gacgcgtacgtctgggtcaaaccgcccggtgagtccgacggcaccggtgtcagccgggac
gtcggccagccgtacgagccgatgtgcgatcccaactacaacccgccgggcggcagcttc
cgcatcaccggggcgctgccgggcggcccgccgttccggcagtggttcccggcgcacttc
cggcagttgctggccaacgcctggccgccgctgtga

DBGET integrated database retrieval system