KEGG   Plantactinospora sp. BC1: C6361_33640Help
Entry
C6361_33640       CDS       T05377                                 

Definition
(GenBank) bifunctional RNase H/acid phosphatase
  KO
K22316  ribonuclease H / adenosylcobalamin/alpha-ribazole phosphatase [EC:3.1.26.4 3.1.3.73]
Organism
plab  Plantactinospora sp. BC1
Pathway
plab00860  Porphyrin and chlorophyll metabolism
plab01100  Metabolic pathways
plab03030  DNA replication
Brite
KEGG Orthology (KO) [BR:plab00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C6361_33640
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    C6361_33640
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:plab03032]
    C6361_33640
Enzymes [BR:plab01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     C6361_33640
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     C6361_33640
DNA replication proteins [BR:plab03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    RNase H
     C6361_33640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 RVT_3 RNase_H
Motif
Other DBs
NCBI-ProteinID: AVT33572
Position
complement(7667954..7669132)
Genome map
AA seq 392 aa AA seqDB search
MPGRKVVVEADGGARGNPGPAGYGAVVRDAGSGEVLAERSESIGVATNNVAEYRGLIAGL
DAAREVGASGVEVRMDSKLVVEQMAGRWQIKHPGLRPLAAQAAGLVRKFDSVTYTWIPRE
RNRHADALANAAMDLAAGKVPEVARDSAAEPEAAAPAGATGRAEAHEVAAQGSTAKSSWE
PRPAETATRLLLLRHGETDYTAKGRYSGRGDVPLSDRGLAQAGATARRVAGLVDQVAAVV
SSPLSRCTAMAGIVAGGLGGVPVVVEPDLIECDFGDWEGRTFAEVRERWPAELDAWLASP
AVAPPGGESFVEVGARVSRAMAKLLADYPGETVVVVSHVSPVKIALRDALAATDAFLHRL
YLDPAGLSLLDIWPDGGMAVRTVNDTAHLTGI
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtgccgggtcgtaaggtcgtggtggaggcggacggcggagcgcggggcaatcccggcccg
gccggttacggggcggtggtccgggacgccggcagcggcgaggtgctggccgagcgttcc
gagtcgatcggcgtcgccaccaacaacgtcgcggaataccgtggcctgatcgccgggctg
gacgccgcccgcgaggtgggcgcgtccggcgtcgaggtgcggatggactccaagctggtg
gtcgagcagatggccggccgctggcagatcaagcacccggggctgcgtccgctcgccgcg
caggcggccgggctggtccggaagttcgactcggtgacgtacacctggattccccgggag
cgcaaccggcacgcggacgcgctggcgaacgcggcgatggacctggcggccggcaaggtg
ccggaggtcgcccgggacagcgcggccgagccggaggccgcggcgccggccggcgcgacc
gggcgggcggaggcgcacgaggtcgccgcgcaggggtcgaccgcgaagagttcctgggag
ccgcgtccggcggagaccgccacccggctgctgctgctccggcacggcgagacggactac
accgcgaagggccgctactccggccggggtgacgtgccgctctccgaccggggcctggcc
caggccggtgcgacggcccggcgggtggccgggctggtcgaccaggtcgcggccgtggtc
agctcgccgctgtcccggtgtacggcgatggccggcatcgtcgccggtggcctcggcggg
gtaccggtggtggtcgagcccgacctgatcgagtgcgacttcggtgactgggaggggcgc
accttcgccgaggtacgcgagcgctggccggccgaactggacgcctggctggcctcgccg
gccgtcgccccgcccggtggggagtccttcgtcgaggtcggcgccagggtcagccgggcg
atggccaagctgctggccgactatccgggggagaccgtggtggtggtctcgcacgtctct
ccggtgaagatcgcgctccgcgacgcgctggccgcgaccgacgccttcctgcaccggctc
tatctcgacccggccggtctgtctctgctggacatctggccggacggcgggatggcggtg
cggaccgtcaacgacacggcccacctgaccggcatctga

DBGET integrated database retrieval system