KEGG   Plantibacter sp. PA-3-X8: EAO79_00355Help
Entry
EAO79_00355       CDS       T05731                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00630  Glyoxylate and dicarboxylate metabolism
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
plap01120  Microbial metabolism in diverse environments
plap01200  Carbon metabolism
Module
plap_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    EAO79_00355 (aceA)
Enzymes [BR:plap01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     EAO79_00355 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AZH84763
UniProt: A0A3G8VNN8
Position
76530..77840
Genome map
AA seq 436 aa AA seqDB search
MPLRAGDQTQTAEELQREWDTDPRWDGVRRDYTAEDVVRLRGGVREEPTLARRGAERLWN
LLHTEEWVPALGALTGNQAVQQVRAGLQAIYLSGWQVAADANLSGQTYPDQSLYPANSVP
AVVRRINNALLRAEQIDFAERAVGETPGPEAIDWLAPIVADAEAGFGGPLNAYELMAGMI
QAGAAGVHWEDQLAAEKKCGHMGGKVLVPTSQHIRTLNAARLAADVAGVPTIVIARTDAL
AATLLTSDIDERDLPFLNGNRTPEGFYEVENGIGPVLARGLAYAEYADLLWVESAEPDLD
LARRFAEAVHERFPGKLLAYNCSPSFNWKSHLDDAQIASFQRELAAMGYAFQFITLAGFH
ALNHSMFTLASDYRERAMSAYVDLQEAEFAAEASGYTATKHQREVGTGYFDLVATALNPG
SATLALAGSTEEQQFH
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgcccctccgcgccggcgaccagacgcagacggccgaggagctgcagcgcgagtgggac
accgacccgcgctgggacggggtacgccgcgactacaccgccgaggacgtcgtccgcctg
cgcggcggtgtccgggaggagccgacgctcgcccgccggggggcggagcgcttgtggaac
ctcctccacaccgaggagtgggtgcctgccctcggcgcgctgaccggcaaccaggccgtg
cagcaggtccgggcgggcctgcaggcgatttacctctccggctggcaggtcgccgccgac
gcgaacctctccgggcagacctaccccgatcagagcctctacccggccaactcggttccg
gcggtcgtccggcggatcaacaacgcgctgctccgggccgaacagatcgacttcgccgag
cgagccgtcggggagacgccgggacccgaggcgatcgactggctcgcgccgatcgtcgcc
gacgccgaagccggcttcggtggaccgctgaacgcctacgaactcatggccggcatgatc
caggccggcgccgcgggcgtccactgggaggaccagctcgcggctgagaagaagtgcggc
cacatgggcggcaaagtgctggtgccgacgagccagcacatccggaccctcaatgcggcc
cggctggcggcggacgtcgccggcgtcccgaccatcgtcatcgcccgcaccgatgcgctg
gccgccaccctcctcacgagcgacatcgacgagcgcgatctgccgttcctgaacgggaac
cggaccccggagggcttctacgaggtggagaacggcatcggtccggtgctcgctcgcggc
ctcgcctacgcggagtacgccgacctgctctgggtcgagtcggcggaacccgacctggac
ctcgcccggcggttcgccgaggccgtccacgagcggttcccgggcaagctgctcgcctac
aactgctcgccgtcgttcaactggaagtcgcacctcgacgatgcgcagatcgcgtccttc
cagcgtgagctcgccgccatgggatacgcattccagttcatcaccctcgccggcttccac
gcgttgaaccactcgatgttcaccctggcgagcgactaccgggagcgggcgatgagcgcc
tacgtcgacctccaggaagccgagttcgccgcagaggccagcggctacaccgccaccaag
caccagcgggaagtcggtaccggctacttcgacctggtcgcgaccgccctcaaccccggc
agcgccaccctcgccctcgccgggtcgaccgaggaacaacagttccactga

DBGET integrated database retrieval system