KEGG   Plantibacter sp. PA-3-X8: EAO79_00580Help
Entry
EAO79_00580       CDS       T05731                                 

Definition
(GenBank) demethylmenaquinone methyltransferase
  KO
K03183  demethylmenaquinone methyltransferase / 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase [EC:2.1.1.163 2.1.1.201]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00130  Ubiquinone and other terpenoid-quinone biosynthesis
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    EAO79_00580
Enzymes [BR:plap01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.163  demethylmenaquinone methyltransferase
     EAO79_00580
    2.1.1.201  2-methoxy-6-polyprenyl-1,4-benzoquinol methylase
     EAO79_00580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ubie_methyltran Methyltransf_11 Methyltransf_25 Methyltransf_23 Methyltransf_31 Methyltransf_12 MetW FtsJ TehB MTS RrnaAD NodS adh_short_C2 Methyltrans_SAM
Motif
Other DBs
NCBI-ProteinID: AZH81553
UniProt: A0A3G8VEP0
Position
complement(122572..123276)
Genome map
AA seq 234 aa AA seqDB search
MNRADLSKQPEQVSAMFDDVSTKYDRMNAVLSVGNDALWRIATTRAVGPAAGERILDLAA
GTGTSSAALARNGAQVVAADFSPGMIAVGRDKYADRSDIQFVEADATDLPFADEEFDATT
ISFGLRNVVRPKDALAEMLRVTKPGGRIVICEFSTPTLAPMRAAYNLYLERVMPLVAGVA
SSNAEAYTYLNDSIRAWPSQPELAAWLREAGYEHVAYRNLTGGIVALHRGLKPA
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccgcgccgacctctccaaacagcccgagcaggtctcggccatgttcgacgacgtc
tcgacgaagtacgaccgcatgaacgcggtcctctccgtcgggaacgacgccctgtggcgc
atcgcgaccactcgtgcggtcggtccggccgccggtgagcgcatcctcgacctcgcggcc
ggcacgggcacgtcctccgcggcgctggcgcgcaacggtgcacaggtcgtggctgccgac
ttctcgcccggcatgatcgccgtgggtcgcgacaagtacgccgaccgctccgacatccag
ttcgtcgaggccgacgcgaccgacctcccctttgccgacgaggagttcgacgcgacgacg
atctccttcggcctccgcaacgtcgtccgcccgaaggacgccctcgccgagatgctccgg
gtcacgaagcccggcggccggatcgtcatctgcgagttctccacgccgaccctcgccccg
atgcgcgccgcctacaacctctacctcgagcgcgtgatgccgctcgtcgccggcgtcgca
tcgtcgaacgccgaggcgtacacctacctcaacgactcgatccgcgcctggccgagccag
ccggagctggccgcctggctgcgtgaagcgggctacgagcacgtcgcgtaccgcaacctc
accggcggaatcgtcgccctacaccgcggactcaagccggcctga

DBGET integrated database retrieval system