KEGG   Plantibacter sp. PA-3-X8: EAO79_00630Help
Entry
EAO79_00630       CDS       T05731                                 

Definition
(GenBank) hypothetical protein
  KO
K01911  O-succinylbenzoic acid---CoA ligase [EC:6.2.1.26]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00130  Ubiquinone and other terpenoid-quinone biosynthesis
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    EAO79_00630
Enzymes [BR:plap01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.26  o-succinylbenzoate---CoA ligase
     EAO79_00630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AZH81562
UniProt: A0A3G8V9L1
Position
complement(133104..134264)
Genome map
AA seq 386 aa AA seqDB search
MTRQLLPVDASASAMLAALETALDGSGPAVLPMQPGSSAAPAVVDVRVALVIETSGSTGV
PKRVALSAEALLASAAGSAVALDGPEAHRRSSQWILALPTHYIAGVNVLLRSIVAGTRPL
EAPTGSFDARAFCGLVERLDADAGFAALVPAQLRMLVDAAETSTSVRDALAGLAGLLVGG
QATPAPLLERSAALGIRVVRSYGSSETSGGCLYDGVPFAGVEPRLVNGELLIAGPVLAEG
YLGEPDRTATAFPDDGGRRWYRTGDTAELVDGVVRVTGRADNVIISGGVNISLDRVQAVV
RSVPGLAEAVVVAVPDERFGQASVIVTGVGTPLDQRPDDALLQTARDAVAEALGRPARPA
RLVRLTELPLLASGKPDLVALRSRLG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtcagctgctccccgtcgacgcgtccgcctcggcgatgctcgcagccctggag
acggcgctcgacggctccggacccgcggtcctcccgatgcaacccggatcgtccgcggca
ccggccgtggtcgacgtccgggtggctctcgtgatcgagacgtccggttcgacgggcgtg
ccgaagcgggtcgccctctcggctgaggccctcctggccagcgcggcgggttccgcggtg
gctctggatggccctgaggcccatcgccgttcgtcccagtggatcctggcactcccgacg
cactacatcgccggcgtcaacgtgctactccggtcgatcgtcgccgggaccaggccgctc
gaggcaccgacagggtcgttcgacgcccgggcgttctgcggactcgtcgagcggctcgac
gcagatgccggattcgccgccctcgtaccggcacaactgcgcatgctcgtcgacgccgcc
gagacgagtacctccgtgcgtgacgcgctcgccggactcgccgggctgctcgtcggggga
caggccacccccgctccgctgctcgagcggtccgcggcgctcggcatccgcgtcgtgcgg
agttacggctcgagcgagacctccggcggctgtctgtacgacggcgtgccgttcgccggt
gtcgaaccccggctggtgaacggggagctcctcatcgccggaccggtgctcgccgagggc
tacctcggcgaaccggaccgcacggcgaccgccttcccggacgacggcggccgccggtgg
taccgcaccggcgacaccgccgagctcgtcgacggcgtcgtccgggtgaccggtcgggcc
gacaacgtgatcatcagcggcggggtgaacatctccctcgaccgggtgcaagcggtcgtc
cggtcggtgccggggctggccgaggccgtcgtcgtcgccgtccccgacgagcggttcggc
caggcgtccgtgatcgtgacgggggtcgggacccccttggaccagcgcccggacgacgcg
ctgctgcagaccgcccgagacgccgtcgcggaggcgctcggccgcccggcgcgccccgcc
cgactggtccgtctgaccgagctgccgctgctcgcgagcggcaaacccgacctcgtcgca
ctccgctcacgactgggctga

DBGET integrated database retrieval system