KEGG   Plantibacter sp. PA-3-X8: EAO79_02780Help
Entry
EAO79_02780       CDS       T05731                                 

Definition
(GenBank) aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00340  Histidine metabolism
plap00350  Tyrosine metabolism
plap00360  Phenylalanine metabolism
plap00400  Phenylalanine, tyrosine and tryptophan biosynthesis
plap00401  Novobiocin biosynthesis
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
plap01130  Biosynthesis of antibiotics
plap01230  Biosynthesis of amino acids
Module
plap_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    EAO79_02780
   00350 Tyrosine metabolism
    EAO79_02780
   00360 Phenylalanine metabolism
    EAO79_02780
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAO79_02780
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    EAO79_02780
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:plap01007]
    EAO79_02780
Enzymes [BR:plap01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     EAO79_02780
Amino acid related enzymes [BR:plap01007]
 Aminotransferase (transaminase)
  Class II
   EAO79_02780
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Alliinase_C SnoaL_2 Met_gamma_lyase
Motif
Other DBs
NCBI-ProteinID: AZH84811
UniProt: A0A3G8VFJ8
Position
complement(569642..570781)
Genome map
AA seq 379 aa AA seqDB search
MPTTAQPAAQPGRSPVRLRPEIADLPPYRQGKPAAPDAFKLSSNEVPFPPLDAVLSAITD
TAANSHRYPDGAALALRTALAEANGVTPERIHIGAGSVALLSQFITATAGPGDEVVFAWR
SFEAYPGLVTVAGATSVRVPNRPDGSHDLEAMAAAVTDRTRVVIVCTPNNPTGPVVERAA
FLAFLRSVPSDVLVLLDEAYREFVTDDDAVNGIPLLDEHPNLVVLRTFSKAYGLAGLRVG
WAIGHELVLDGARNAAIPLSSTAPAQQAAIAGLANAEDIRARVAVITARRDDLAAALREQ
GWFIPAAQGNFVWFGLGEQTAAANETFLAHGIVGRAFPGDGVRISIGEAESIEPLLAAAA
EILAGLPADHPTREGVRSR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
ctgccaaccaccgcccagccggccgctcagccgggccggagcccggtccgtctccgtccg
gagatcgcagatctgccgccctaccgtcagggcaagccggccgcacccgacgccttcaag
ctctccagcaacgaggtcccgttcccgccgctcgacgccgtcctctcggccatcaccgac
acggctgcgaactcccaccgctaccccgacggcgccgcactcgcgttgcgcacggcgctc
gccgaagccaacggcgtcacgccggaacgcatccacatcggggcgggctcggtcgcactc
ctcagccagttcatcaccgccaccgccggtccgggagacgaggtcgtcttcgcctggcga
tccttcgaggcctacccgggtctcgtgaccgtcgccggcgcgacgtccgtgcgcgtcccg
aaccggcccgacggctcccacgacctcgaggcgatggccgcagccgtcaccgaccgcacc
cgcgtcgtcatcgtctgcacgccgaacaaccccacgggcccggtcgtcgagcgcgccgcc
ttcctcgccttcctccgctccgtgccgtcggacgtgctcgtcctcctcgatgaggcctac
cgcgagttcgtcaccgacgacgacgccgtcaacggcatcccgctcctcgacgagcacccg
aacctcgtcgtgctccgcaccttctcgaaggcttacggactcgccggcctccgcgtcggc
tgggccatcggccacgagctcgtcctcgacggcgcccgcaacgcggccatcccgctctcc
agcaccgcgccggcgcagcaggcggccatcgccggactcgcgaacgccgaggacatccga
gcccgcgtcgcggtcatcaccgcccgacgcgacgacctcgccgccgcactccgcgagcag
ggctggttcatccccgcggcacagggcaacttcgtctggttcggcctcggcgagcagacg
gccgcggcgaacgagaccttcctcgcgcacggcatcgtcggccgcgccttccccggcgac
ggcgtccgcatctcgatcggtgaagccgagtcgatcgaaccgctcctcgccgccgctgca
gagatcctcgccggactgccggccgaccacccgacacgagagggagtgcgctcacgatga

KEGG   Plantibacter sp. PA-3-X8: EAO79_15380Help
Entry
EAO79_15380       CDS       T05731                                 

Definition
(GenBank) histidinol-phosphate transaminase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00340  Histidine metabolism
plap00350  Tyrosine metabolism
plap00360  Phenylalanine metabolism
plap00400  Phenylalanine, tyrosine and tryptophan biosynthesis
plap00401  Novobiocin biosynthesis
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
plap01130  Biosynthesis of antibiotics
plap01230  Biosynthesis of amino acids
Module
plap_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    EAO79_15380
   00350 Tyrosine metabolism
    EAO79_15380
   00360 Phenylalanine metabolism
    EAO79_15380
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAO79_15380
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    EAO79_15380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:plap01007]
    EAO79_15380
Enzymes [BR:plap01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     EAO79_15380
Amino acid related enzymes [BR:plap01007]
 Aminotransferase (transaminase)
  Class II
   EAO79_15380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AZH84113
UniProt: A0A3G8VLR3
Position
complement(3255910..3256989)
Genome map
AA seq 359 aa AA seqDB search
MTALDDLPIRDDLRGQRPYGAPQALVPVALNVNENTHPIPEAVAHDIVASLASAVLTVNR
YPDREFTELREALAGYLGHGVVPEQIWAGNGSNEVLQHILQAFGGPGRSLLGFTPTYSMY
PLLAAGVGTRWIPATRDAEFELSPETAARQVAEADPDLVFLCSPNNPTGTPLSLETVTAV
YEASRGMVIVDEAYAEFAPDDEASALTLLEGRPRLIVSRTMSKAFAFAGVRLGYLAADPA
VVDALRLVRLPYHLSALTQAAATAALRHADEMLAMVDDIRTQRDRLVVELGRLGYDSKRS
GSNFVLFGGVADPHAAFEALLARGILIRDVGIPNHLRVTAGTEAETTAFLEALAAISPA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgctctcgacgacctccccatccgcgacgacctccgaggacagcgcccgtacggc
gctccccaggccctggtgccggtggcgctcaacgtgaacgagaacacgcacccgatcccc
gaggcggtcgcgcacgacatcgtcgcctcgctcgcctccgcggtcctcacggtgaaccgg
taccccgatcgcgagttcacggaactccgggaggcgctggcgggatacctgggtcacggg
gtggtcccggagcagatctgggcggggaacgggtcgaacgaggtgctccagcacatcctg
caggccttcggtggtcccgggcgatcgctcctcgggttcacgccgacgtactcgatgtat
ccgctcctggccgccggcgtcggcaccaggtggatccccgcgacgcgcgacgccgagttc
gagctctcgcccgagaccgccgcccgtcaggtggccgaggcggatcccgacctcgtgttc
ctctgctcgcccaacaaccccaccggaacaccgttgtcgctcgagaccgtcaccgcggtg
tacgaggcctcgcggggcatggtgatcgtcgacgaagcgtatgcggagttcgctcctgac
gacgaggcgagcgcgctcacgctgttggaggggcgtcctcgcctgatcgtctccaggacg
atgagcaaggccttcgccttcgccggggtccgtctcgggtacctcgccgccgaccccgcg
gtcgtcgacgcactgagactcgtccggctcccgtaccacctgagcgccctgacgcaggcg
gccgcgaccgccgcgctgcggcacgccgacgagatgctggcgatggtcgacgacatccgg
acgcagcgcgatcgcctcgtcgtcgagctcgggcgtctcggctacgactcgaagcggagc
ggatccaacttcgtcctgttcggcggcgtcgccgatccgcacgcggcgttcgaggcgctc
ttggcgcgggggatcctcatccgtgacgtgggcatcccgaaccacctgcgcgtgaccgcg
ggcaccgaagcggagacgaccgcgttcctcgaggccctggcggcgatcagccccgcctga

DBGET integrated database retrieval system