KEGG   Plantibacter sp. PA-3-X8: EAO79_03620Help
Entry
EAO79_03620       CDS       T05731                                 

Definition
(GenBank) primary-amine oxidase
  KO
K00276  primary-amine oxidase [EC:1.4.3.21]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00260  Glycine, serine and threonine metabolism
plap00350  Tyrosine metabolism
plap00360  Phenylalanine metabolism
plap00410  beta-Alanine metabolism
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAO79_03620
   00350 Tyrosine metabolism
    EAO79_03620
   00360 Phenylalanine metabolism
    EAO79_03620
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EAO79_03620
Enzymes [BR:plap01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.21  primary-amine oxidase
     EAO79_03620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cu_amine_oxid Cu_amine_oxidN3 Cu_amine_oxidN2
Motif
Other DBs
NCBI-ProteinID: AZH82085
UniProt: A0A3G8VNR0
Position
complement(750776..752818)
Genome map
AA seq 680 aa AA seqDB search
MTITDPTNLRSADDDAPVQHPLASLSAPEFDRIRDIVTGFDDFTETTRFAYVGLEEPHKR
AVLAWQAGDGPLPERLARVMLLDMATGRSTDNVVSIDSGSLLSTVVLDGSRGQLPILIEE
FDAIAEIVAEDEGWVAALAARGCTVDEVKVVPLSAGFYDYPEEVGRRIVRVLAFRQDYPA
DHPWAHPVDGLSAYVDTAARRITRLIDATALAIPAEPGNFDDPAVQGAPLSSLKPIVITQ
PEGPSFQVDGEFVEWGNWRFQVGFDVREGLVLRQLSFDDAGEERPIIYRASINEMLVPYG
DPSPVRFWQNYFDTGEYLFGRFTNSLALGCDCVGEIKYFDAVLADELGNPFTIENGICMH
EEDFGTLWKHSDLYTGSNEVRRSRRLVISFFTTVGNYDYGFYWYLYLDGTIECESKLTGI
LFTSAYPGLDAEGADYPYASEVAPGLGGPYHQHLFSARLDMMVDGLSNAVEEVDAVRVPI
GPGNEHGNAFTKRVTRLSTEAGSGRVADGSAARAWHIVNTEKTNRMGRPTGYVLYPQESP
TLMADASSSIAKRAEFATKHLFVTKYDPAERYAAGDFVHQNPGGDGITRFIEGDESIDGE
DIVLWHTFGPTHFPRPEDWPVMPVDYARFTLKPYGFFGKNPTLNVPPNEAVGHCSHDTGA
AHVGHGGHDQGAEEHCGHGH
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcaccgaccccacaaacctgcgcagcgccgacgacgacgcccccgtccagcac
ccgctcgccagcctgtccgcacccgagttcgaccgcatccgcgacatcgtcaccggcttc
gacgacttcaccgagacgacccggttcgcctacgtcggcctcgaggagccccacaagcgg
gcggtgctcgcctggcaggccggcgacggtccactgccggaacgcctcgcccgcgtgatg
ttgctcgacatggccacgggtcgatcgacggacaacgtggtgtccatcgacagcgggtcc
ctgctcagcacggtcgtgctggacggctcccgcggccaactgccgatcctcatcgaggag
ttcgacgccatcgcggagatcgtggcggaggacgaggggtgggtcgccgccctcgccgcc
cgtggctgcacggtcgacgaggtgaaggtcgtcccgctgtcggccggcttctacgactat
cccgaggaggtcgggcgccggatcgtccgggtcctcgccttccgtcaggactacccggcc
gaccacccgtgggcccaccccgtcgacggactgagcgcctatgtcgacaccgcggcgcgg
cggatcacccggctgatcgacgcgactgcgctggccattccggcggagccggggaacttc
gacgacccggcggtccagggtgctccgctctcctcgctcaagccgatcgtcatcacccag
ccggagggtccgagcttccaggtcgacggcgagttcgtcgagtggggcaattggcggttc
caggtcgggttcgacgtccgcgagggcctcgtcctccgtcagctgtcgttcgacgacgcc
ggcgaggaacgaccgatcatctaccgggcgtcgatcaacgagatgctggtcccctacggc
gacccctcccccgtgcgcttctggcagaactacttcgacaccggcgagtacctgttcggc
cggttcacgaactccttggcgctcgggtgcgactgcgtgggcgagatcaagtacttcgac
gcggtcctcgccgatgagctcggcaacccgttcacgatcgagaacgggatctgcatgcac
gaggaggacttcggcaccctctggaagcactccgacctgtacaccggctcgaacgaggtc
cggcggtcgcgtcggctggtcatctccttcttcacgaccgtcggcaactacgactacggg
ttctactggtacctgtacctcgacggcaccatcgagtgcgagtcgaagctgacgggcatc
ctcttcacctccgcgtaccccgggctcgacgcggagggcgccgactacccgtacgcctcg
gaggtcgcgcccgggctcggtgggccctaccaccagcacctcttctcggcccgtctggac
atgatggtcgacggtctgtcgaacgcggtcgaggaggtggacgcggtccgggtgccgatc
gggccggggaacgagcacggcaacgccttcacgaagcgggtcacgcggctcagcacggaa
gcggggtccgggcgcgtggcggacggttcggccgctcgagcctggcacatcgtcaacacg
gagaagacgaaccggatgggacgcccgacggggtacgtgctgtacccgcaggagtcgccg
acgctcatggccgacgcgtcgtcgtcgatcgccaagcgggcggagttcgcgacgaagcac
ctcttcgtgacgaagtacgacccggctgaacgatacgcggcgggcgacttcgtccaccag
aacccgggtggcgacgggatcacgcgcttcatcgagggcgacgagtcgatcgacggcgag
gacatcgtgctctggcacaccttcggaccgacgcacttcccccgtccggaggactggccg
gtcatgccggtggactacgcccggttcacgctcaagccctacggcttcttcggcaagaac
ccgaccctgaacgtcccgccgaacgaagcggtcgggcactgttcgcacgacaccggcgcc
gcgcacgtgggacacggcggtcacgaccagggcgccgaagagcactgtggccacgggcac
tag

DBGET integrated database retrieval system