KEGG   Plantibacter sp. PA-3-X8: EAO79_05050Help
Entry
EAO79_05050       CDS       T05731                                 

Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00030  Pentose phosphate pathway
plap00480  Glutathione metabolism
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
plap01120  Microbial metabolism in diverse environments
plap01130  Biosynthesis of antibiotics
plap01200  Carbon metabolism
Module
plap_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
plap_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EAO79_05050
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EAO79_05050
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:plap04147]
    EAO79_05050
Enzymes [BR:plap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     EAO79_05050
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     EAO79_05050
Exosome [BR:plap04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   EAO79_05050
  Exosomal proteins of colorectal cancer cells
   EAO79_05050
  Exosomal proteins of bladder cancer cells
   EAO79_05050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AZH82333
UniProt: A0A3G8VGS2
Position
1064090..1065526
Genome map
AA seq 478 aa AA seqDB search
MSDQSDTTTQPDPDTVPGIPDAESLEPTKRTIAILGANGDLAKRLLIPGLGEVVDAARDI
SLQIIGAARTPQPNEEWRATVRASLEDAGIGARAVDALVSTTEFIPTDASDPDELRALLD
ACTGSPILYIALPPSAGRKVAEALAQIDLPDDLLIAIEKPFGDDLADAQALNAALADVVP
EERLWRIDHFLGNATVLGMLGLRFGNRLLEAGWNAEQIEKVEILYDEELGLEGRAAFYDQ
TGALRDMLQSHLLMVLALTAMERPDAVTPTDVHDRIAEVLGAVRLWKDDPSTARRARYTE
GRVGDRLFPSYVDEPDVDASREAETLAQLLLQVDTPRWQGVPFVLRSGKGIGDPRREVAV
HFRRSAAPTGLDAPDGHSDTVLRMSLKGGAVHLDLIVTGADDVDGLRRVELEADPGAATL
SAYAQVLAGLLQENTLLSVRGDIAEQCWRIVTPVLTAWSAGETPLEEYEAGSAGPTDW
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaccagtccgacaccaccacccagcccgatcccgacaccgtacccggcatcccg
gacgcggagtcgctggagccgacgaagcgcaccatcgccatcctcggcgccaacggcgac
ctggccaagcggctcctgatccccggcctcggcgaggtcgtcgacgccgcacgcgacatc
tcgctgcagatcatcggcgccgcccgcacgccgcagccgaacgaggagtggcgtgcgacc
gtccgcgccagtctcgaggacgccggcatcggagcccgggccgtcgacgcgctggtgtcg
acgacggagttcatcccgaccgacgcctccgaccccgacgaactgcgtgcactgctcgac
gcctgcaccggctcgccgatcctctacatcgcgctcccaccgtccgccgggcgcaaggtc
gccgaggcgctcgcgcagatcgacctgcccgacgacctcctcatcgccatcgagaagccg
ttcggcgacgacctcgccgacgcccaggcgctcaacgcggcgctcgccgacgtcgtgccg
gaggagcgtctgtggcgcatcgaccacttcctcggcaacgcgaccgtcctcgggatgctc
ggcctccgcttcggcaaccgactcctcgaggcgggctggaacgcggaacagatcgagaag
gtggagatcctctacgacgaggagctggggctcgaggggcgtgcagcgttctacgaccag
accggcgctctgcgcgacatgttgcagagccacctgctcatggtcctcgccctcacggcg
atggagcgtccagacgcggtgacgccgaccgacgtccacgaccgcatcgccgaggtcctc
ggcgccgtgcgactgtggaaggacgacccgtccaccgcccgtcgcgcccgctacaccgag
ggccgggtcggcgaccggctcttcccctcctatgtggacgagcccgacgtcgacgcctcc
cgcgaggcggagacgctcgcacagctcctgctccaggtcgacaccccgcgttggcagggc
gtgccgttcgtcctgcgctccggcaagggcatcggtgacccgcgccgcgaggtcgccgtg
cacttccgccgctcggctgcgccgaccggactggacgctccggacggacactccgacacc
gtcctccgcatgtcgctcaagggcggtgcagtgcacctcgacctcatcgtgaccggagcc
gatgacgtcgacggcctgcgccgggtcgagctcgaggccgatcccggagctgcgaccctc
agcgcctacgcgcaggtgctcgccggcctcctgcaggagaacacgctgctgtcggtgcgc
ggcgacatcgccgagcagtgctggcgcatcgtcaccccggtcctcaccgcctggtccgct
ggtgagacgccgctcgaggagtacgaggcggggagcgccggtccgacggactggtga

DBGET integrated database retrieval system