KEGG   Plantibacter sp. PA-3-X8: EAO79_06310Help
Entry
EAO79_06310       CDS       T05731                                 

Definition
(GenBank) anion permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
plap  Plantibacter sp. PA-3-X8
Brite
KEGG Orthology (KO) [BR:plap00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    EAO79_06310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF3021
Motif
Other DBs
NCBI-ProteinID: AZH84889
UniProt: A0A3G8VFF7
Position
1305128..1306339
Genome map
AA seq 403 aa AA seqDB search
MDPIILLSLVVITALAFDFTNGFHDTANAMATSIATGALSPKVAVTLSAVLNLVGAFLSI
EVALTVTNAVVKIQDSSGAPDPALLEGGGSALLLIVLAGLIGGIIWNLLTWLLGLPSSSS
HALFGGLIGSTLAGLGLNGVNWAGDGSKLDGVVGKVILPALMSPVLAGAVAAIGTWLVFR
VIGNLAQGRLHRGFRIGQIGSASLVSLAHGTNDAQKTMGVITLALIAAGGWDDTESVPLW
VKLACALAISLGTYIGGWRIIRTVGKGIVELNTPQGMAAESSSAAVILASSHLGFALSTT
HVATGSILGSGVGRPGAQVRWRVALRMVVAWIITLPAAALMGAVMWWVGHLVGGAIGGIL
MVAILVGVALAIYLRSRRDSIGSHNVNDDWQDAPARSSQKTTA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
gtggaccccatcatcctgctctcgctcgtcgtgatcacggcactcgccttcgacttcacc
aacggcttccacgacaccgcgaacgcgatggcgacctccatcgccaccggtgcgctgtcg
ccgaaggtcgcggtcaccctctcggcggtgctgaacctcgtgggcgcgttcctcagcatc
gaagtcgcgctcaccgtcacgaacgcggtcgtgaagatccaggactcgtcgggagctccc
gatccggcgctcctcgagggagggggctcggcgctcctgctgatcgtgctcgccggactc
atcggtggcatcatctggaacctgctcacctggctgctcggtcttccgtcgagctcgtcg
cacgcgctgttcggcggtctcatcggctcgacgctcgcgggcctcggcctgaacggcgtg
aactgggccggtgacggctcgaagctcgacggcgtcgtcggcaaggtcatcctcccggcg
ctcatgtcgccggtgctcgccggcgcggtggcggcgatcggcacctggctcgtcttccgc
gtcatcggcaacctcgcccaggggcgtctccatcgcggcttccggatcgggcagatcggc
agtgcgtccctcgtctcgctcgcccacggcacgaacgacgcgcagaagacgatgggcgtc
atcaccctcgcgctcatcgcggccggcggctgggacgacaccgagtcggtcccactctgg
gtgaagctcgcctgtgccctcgcgatctcgctcggcacgtacatcggcgggtggcggatc
atccgcaccgtcggcaagggcatcgtggagttgaacacaccgcagggcatggccgccgag
agttcctccgccgccgtcatcctcgcctcgagccacctcggcttcgccctcagcaccacg
cacgtcgcgaccggatcgatcctcggctccggggtcggacgaccgggcgcgcaggtgcgc
tggcgggtggccctgcggatggtcgtcgcctggatcatcaccctcccggctgccgcgctc
atgggcgcggtgatgtggtgggtcggtcacctcgtgggcggagcgatcggcggaatcctc
atggtcgcgatcctcgtcggtgtcgcgctcgccatctacctccggtcgcgccgcgacagc
atcggatcccacaacgtgaacgacgactggcaggacgcccccgcccgctcgtcgcagaag
accacagcgtaa

DBGET integrated database retrieval system