KEGG   Plantibacter sp. PA-3-X8: EAO79_08815Help
Entry
EAO79_08815       CDS       T05731                                 

Definition
(GenBank) amino-acid N-acetyltransferase
  KO
K00619  amino-acid N-acetyltransferase [EC:2.3.1.1]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00220  Arginine biosynthesis
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
plap01130  Biosynthesis of antibiotics
plap01210  2-Oxocarboxylic acid metabolism
plap01230  Biosynthesis of amino acids
Module
plap_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    EAO79_08815
Enzymes [BR:plap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     EAO79_08815
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10
Motif
Other DBs
NCBI-ProteinID: AZH82986
UniProt: A0A3G8VD84
Position
1844001..1844519
Genome map
AA seq 172 aa AA seqDB search
MVEQAQQGYVVRRARTSDVRRIQALVEPLVQQRILLGKDDVVFYEAVQEFRVAETPDGEL
IGCGALHVIWEDLGEVRTLAVSADHLGTGVGHALVERLEHDAVELGLRRLFCLTFETGFF
TRHGYQEIGEEIVPPEVYAQLVRSSDEGVAEFLDLARVKPNTLGNTRMLKLL
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagcaggctcagcaggggtatgtggtccgtcgcgcccgcacgagcgacgtccgc
cgcatccaggcgctcgtcgaaccactcgtgcagcagcgcatcctcctcggcaaggacgac
gtcgtcttctacgaagcggtccaggagttccgcgtcgccgagacacccgacggcgaactc
atcggctgcggcgcgctgcacgtcatctgggaggacctcggtgaggtccgcacgctcgcc
gtctccgcagaccacctcggcaccggggtcggccacgcgctcgtcgagcgcctcgagcac
gacgcggtcgagctcggtctgcgtcgcctgttctgcctgaccttcgaaaccggcttcttc
acgaggcacggctatcaggagatcggcgaggagatcgtcccacccgaggtctacgcacag
ctcgtgcgctcgtcggacgaaggtgtcgcggagttcctcgacctcgcgcgggtcaagccg
aatacgctcggtaacacgcggatgctcaagctgctctga

KEGG   Plantibacter sp. PA-3-X8: EAO79_15265Help
Entry
EAO79_15265       CDS       T05731                                 

Gene name
argJ
Definition
(GenBank) bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase ArgJ
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00220  Arginine biosynthesis
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
plap01130  Biosynthesis of antibiotics
plap01210  2-Oxocarboxylic acid metabolism
plap01230  Biosynthesis of amino acids
Module
plap_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    EAO79_15265 (argJ)
Enzymes [BR:plap01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     EAO79_15265 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     EAO79_15265 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-ProteinID: AZH84092
UniProt: A0A3G8VG77
Position
complement(3234253..3235422)
Genome map
AA seq 389 aa AA seqDB search
MSVTAAAGFLAAGVACGLKTSGGLDLAVVQNVGPLQHAATVFTSNRCKANPILWSEQVMQ
DGIVSAIVLNSGGANCYTGTRGFQTTHATAEAVAERLAISAGDVLVCSTGLIGEQLDLDK
LTAGVWDATRAVADEDGASEAAGLAAATAIMTTDTKPKQAVRSADGWTVGGMAKGAGMLA
PGLATMLVVITTDAVLEPAQLDQALRSATRVTFDRLDSDGCMSTNDTVSLLASGSSGVTP
ELSAFTEALTEVCRDLTLQLQADAEGAAHDVAIEVVGAVSEDDAVEVARAVSRSNLFKAA
IFGNDPNWGRVLAAVGTTGAEFDPYGIDVAMNGVQVCTAGEPDQSRDLVDLSPRAVHVLI
DLHAGDTGATIWTNDLTHDYVHENSAYAS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtgacagcagcagcagggttcctcgcggcgggcgtcgcctgcggtctcaagacc
tccgggggcctcgacctcgcggtcgtccagaacgtcggtccgttgcagcatgcggcgacg
gtgttcaccagcaaccggtgcaaggccaacccgatcctctggagcgagcaggtcatgcag
gacggcatcgtctcggcgatcgtcctgaactctggcggcgcgaactgctacacggggacg
cgcggtttccagacgacgcacgcgaccgcggaggccgtcgcagagcgactcgcgatctcg
gccggcgacgtcctcgtctgctccacggggctcatcggcgaacagctcgacctcgacaag
ctgaccgcgggcgtctgggacgccacccgcgcggtcgccgacgaggacggtgcgagcgaa
gcggccggcctcgccgcggccacggcgatcatgacgaccgacacgaagccgaaacaggcc
gttcggagcgcggacggatggaccgtcggcggcatggcgaagggtgcgggtatgctcgcc
cccgggctcgcgacgatgctcgtcgtcatcacgaccgacgccgtgctcgagccggcgcag
ctcgaccaggcgctccgcagcgcgacccgtgtcaccttcgaccgcctcgactccgacggc
tgcatgtccaccaacgacacggtgtcgctcctcgcgtccgggtcgagcggcgtcaccccg
gagctgtccgccttcaccgaggcgctgacggaggtgtgccgcgacctcaccctgcaattg
caagccgatgccgagggcgcggcccacgacgtcgcgatcgaggtcgtcggcgcggtgtcc
gaggacgacgcggtcgaggtcgcccgcgcggtctcccgcagcaacctcttcaaggcggcc
atcttcggcaacgacccgaactggggccgggtgctcgcggccgtcgggaccacgggcgcc
gagttcgacccgtacgggatcgacgtggccatgaacggcgtccaggtgtgcaccgccggc
gagccggatcagtcgcgcgacctcgtcgacctctcaccgcgcgccgtgcacgtgctcatc
gacctccacgccggtgacacgggagccaccatctggacgaacgacctcacgcacgactat
gtgcacgagaacagcgcgtacgcgagctga

DBGET integrated database retrieval system