KEGG   Plantibacter sp. PA-3-X8: EAO79_10540Help
Entry
EAO79_10540       CDS       T05731                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00450  Selenocompound metabolism
plap00970  Aminoacyl-tRNA biosynthesis
plap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    EAO79_10540
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    EAO79_10540
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:plap01007]
    EAO79_10540
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:plap03016]
    EAO79_10540
Enzymes [BR:plap01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     EAO79_10540
Amino acid related enzymes [BR:plap01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   EAO79_10540
Transfer RNA biogenesis [BR:plap03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    EAO79_10540
 Prokaryotic type
   Other AARSs
    EAO79_10540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AZH83290
UniProt: A0A3G8VQV6
Position
2211925..2213505
Genome map
AA seq 526 aa AA seqDB search
MADGTSFYITTPIFYVNDAPHIGHAYTEVAADVLARWHRQAGDRTWFLTGTDEHGQKILR
TATANGVTPKEWADKLVSESWYPLLDTIDISNDDFIRTTDVRHEQNVQLFLQRLYDAGFI
YTGEFEGYYCVGCEEYKQESDLVQGTGEYVGQLVCAIHSKPVELLQESNYFFRMSDFAER
LLALYEERPEFVQPESARNEVIQFVRQGLKDLSISRSTFDWGIKVPWDESHVVYVWFDAL
LNYITAAGYGSDEEAFAERWPATQIVGKDILRFHAVIWPAMLMAAGLEVPKRVFGHGWLL
VGGEKMSKSKLTGIAPSEITDTFGSDAFRYYFMRAIAFGQDGSFSWEDLSARYQAELANG
FGNLASRVLAMVTRYFDGVVPASGPAEPADVAIQETVARAAADADAAIERLAIQDALAAI
WRIVDELNGYITEQEPWALAKDEAKRERLGTVLATAVEGLRALSVLLHPFVPKATTKLWS
ALGAEAALGELGAQRIGDVGTWGQLPAGTSVAGLEPLFPRIEAVAE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggccgacggcacctcgttctacatcaccacgcccatcttctacgtcaacgatgccccg
cacatcgggcacgcctacacggaggtggccgcggacgtcctcgcgcgctggcaccgtcag
gccggcgaccgcacctggttcctgaccgggaccgacgagcacggccagaagatcctgcgc
acggcgaccgcgaacggcgtgacgccgaaggagtgggccgacaagctcgtgagcgagtcc
tggtacccgctgctcgacacgatcgacatctcgaacgacgacttcatccgcacgacggac
gtgcggcacgaacagaacgtccagctcttcctccagcgcctgtacgacgccggcttcatc
tacaccggtgagttcgaggggtactactgcgtcggctgtgaggagtacaagcaggagagc
gacctcgtgcagggcaccggtgagtacgtcgggcagctggtgtgcgcgatccattcgaag
ccggtcgaactgctccaggagagcaactacttcttccgcatgagcgacttcgccgagcgc
ctgctggccctctacgaggagcgaccggagttcgtgcagccggagtcggcgcgcaacgag
gtcatccagttcgtgcgccaggggctcaaagacctgtccatctcccgctcgaccttcgac
tggggcatcaaggtcccgtgggacgagagccacgtcgtctacgtgtggttcgacgccctg
ctcaactacatcaccgccgccgggtacggctccgacgaggaggcgttcgccgagcgctgg
cccgccacgcagatcgtcggcaaggacatcctgcggttccacgcggtcatctggccggcc
atgctcatggccgccgggctcgaggtcccgaagcgggtcttcggtcacggctggctgctc
gtcggcggcgagaagatgtcgaagtcgaagctcaccggtatcgcaccgagtgagatcacc
gacaccttcggctccgacgcgttccgctactacttcatgcgcgccatcgccttcgggcag
gacggttcgttcagctgggaggacctctccgcgcggtaccaggcggagctcgcgaacggc
ttcggcaacctcgcgtcgcgcgtgctcgccatggtgacgcggtacttcgacggcgtcgtg
ccggcaagcggccctgccgaaccggccgacgtggccatccaggagacggtcgcccgggcg
gctgcggacgccgacgccgcgatcgagcgcctagccatccaggacgcgctcgcggccatc
tggcggatcgtcgacgagctgaacggctacatcaccgagcaggagccgtgggcactcgcg
aaggacgaggccaagcgggagcggctcggcaccgtgctcgccacggcggtcgagggcctg
cgcgccctgtcggtcctgctccaccccttcgtcccgaaggcgaccaccaagctgtggtcc
gccctcggcgctgaagccgccctcggcgagctcggcgcacagcgcatcggcgatgtcggc
acctgggggcagctgcccgccggcacctcggtggcagggctcgagcccctgttcccgcgg
atcgaggccgtcgccgaatga

DBGET integrated database retrieval system