KEGG   Plantibacter sp. PA-3-X8: EAO79_10655Help
Entry
EAO79_10655       CDS       T05731                                 

Definition
(GenBank) gluconokinase
  KO
K00851  gluconokinase [EC:2.7.1.12]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00030  Pentose phosphate pathway
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
plap01120  Microbial metabolism in diverse environments
plap01130  Biosynthesis of antibiotics
plap01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    EAO79_10655
Enzymes [BR:plap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.12  gluconokinase
     EAO79_10655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_18 AAA_33 Cytidylate_kin2 CoaE Cytidylate_kin AAA_17
Motif
Other DBs
NCBI-ProteinID: AZH84981
UniProt: A0A3G8VG03
Position
2237196..2237675
Genome map
AA seq 159 aa AA seqDB search
MGVSGSGKSTTGVLIADRLGVPFVDADALHPLENVRKMAAGTPLEDPDRWPWLALVGKAL
ADASDTGLVMACSALRRAYREAILAEAPGVRFVLLHGSREVLGRRMEGRSGHFMPPSLLD
SQFALLEDLDADEPGFVVDVDATVDEIVDEAVAGLSAVR
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtgtccgggtccgggaagagcacgaccggggtgctgatcgccgaccggctcggg
gtgcccttcgtcgacgccgacgccctgcacccgctcgagaacgtgcgcaagatggccgcc
ggaacgccgctcgaggaccccgaccgctggccctggctggccctcgttggcaaagcactc
gccgacgcctcggacaccgggctcgtgatggcctgctccgcactccgacgggcctaccgg
gaggcgatcctcgcggaggcgccaggggtgcggttcgtgctcctgcacggctcgcgcgag
gtgctcggacgccggatggagggcaggagcggtcacttcatgccgccgtcgctcctcgac
tcgcagttcgcactcctcgaagacctggacgccgacgaaccgggcttcgtggtggacgtc
gacgccaccgtcgacgagattgtggacgaggcggtcgcgggcctcagcgcggtgcgatag

DBGET integrated database retrieval system