KEGG   Plantibacter sp. PA-3-X8: EAO79_10930Help
Entry
EAO79_10930       CDS       T05731                                 

Definition
(GenBank) fructose-bisphosphatase class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00010  Glycolysis / Gluconeogenesis
plap00030  Pentose phosphate pathway
plap00051  Fructose and mannose metabolism
plap00680  Methane metabolism
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
plap01120  Microbial metabolism in diverse environments
plap01130  Biosynthesis of antibiotics
plap01200  Carbon metabolism
Module
plap_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAO79_10930
   00030 Pentose phosphate pathway
    EAO79_10930
   00051 Fructose and mannose metabolism
    EAO79_10930
  09102 Energy metabolism
   00680 Methane metabolism
    EAO79_10930
Enzymes [BR:plap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     EAO79_10930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AZH83356
UniProt: A0A3G8VEG4
Position
2292964..2293959
Genome map
AA seq 331 aa AA seqDB search
MIERTPDTDLLDGFLDATRAAAAAVAGLVGGGDGMRIDGVAVDALRRALESLPVDGRVVV
GEGEKDRAPMLFVGERFGTGAGPAIDLAVDPVDGTKLAASGKPDSVAVIAIAPRGAMFDI
GPAYYLEKLVAAGGGRELSLADPIAVTLDRPAARLGRPVEQLRVAVQDRPRNAATAQAVT
AAGAELVSFMDGDVALSLRAAAADGDLDLLLGVGGAPEGILTAAAVRALGGWMTARFAPQ
SPEERARLAEARTDLDREVPLDELCRDDAWLLLSAVTSTALAAGAELAGVRVEADGGVMV
ESAVVGPGSPLTRSRKRLDRDAPSGLPSPVR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgatcgagcgcactccggacaccgacctcctcgacggcttcctcgacgccacgagggcc
gcggctgccgccgtcgcgggtctcgtcggaggtggagacggcatgcgcatcgacggggtc
gccgtcgatgcgctccgccgagcgctcgaatcgctcccggtcgacgggcgcgtcgtcgtg
ggggagggcgagaaggaccgggcgcccatgctcttcgtcggggaacgtttcggcacggga
gcggggccggcgatcgacctcgccgtcgaccccgtggacggcacgaagctcgctgcctcc
gggaagccggactccgtcgccgtgatcgccatcgccccgcgcggtgcgatgttcgacatc
ggcccggcgtactacctcgagaagctcgtcgccgccggcgggggacgcgagttgtcgctg
gccgacccgatcgcggtgaccctcgaccggcccgcggcccggctggggcggccggtcgag
cagctgcgggtcgcggtccaggaccgtccgcggaacgcggcgaccgcccaggccgtgacc
gccgccggtgccgagctcgtgagcttcatggacggcgacgtcgccctgtccctgcgggcc
gcggccgccgacggcgacctcgatctgctcctcggtgtgggaggagcccccgagggcatc
ctcacggctgccgcggtccgggccctcggtggttggatgacagcgcgcttcgcaccgcag
tcgccggaggaacgtgcgcggctcgccgaggccaggaccgatctcgatcgcgaggtcccg
ctcgacgaactctgccgcgatgacgcctggctgctgctcagcgccgtcacgtcgaccgcg
ctcgccgccggagccgaactcgccggagtccgggtcgaagcggacggcggtgtcatggtc
gagtccgccgtcgtcggtcccggaagcccgctgacgaggtcacggaagcgcctcgatcga
gacgcacccagcggccttcccagcccggttcgatag

KEGG   Plantibacter sp. PA-3-X8: EAO79_10935Help
Entry
EAO79_10935       CDS       T05731                                 

Gene name
glpX
Definition
(GenBank) class II fructose-bisphosphatase
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00010  Glycolysis / Gluconeogenesis
plap00030  Pentose phosphate pathway
plap00051  Fructose and mannose metabolism
plap00680  Methane metabolism
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
plap01120  Microbial metabolism in diverse environments
plap01130  Biosynthesis of antibiotics
plap01200  Carbon metabolism
Module
plap_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAO79_10935 (glpX)
   00030 Pentose phosphate pathway
    EAO79_10935 (glpX)
   00051 Fructose and mannose metabolism
    EAO79_10935 (glpX)
  09102 Energy metabolism
   00680 Methane metabolism
    EAO79_10935 (glpX)
Enzymes [BR:plap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     EAO79_10935 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AZH83357
UniProt: A0A3G8VF59
Position
2294010..2295008
Genome map
AA seq 332 aa AA seqDB search
MEDPVTQPETGSHYLQPDRNLAMELVRATEAAAIRAAPFIGRGDKNAADGAAVDAMRAFL
GTVNFDGVVVIGEGEKDEAPMLFNGEHVGNGRGPSCDIAVDPIDGTSLTAAGRQNALSVI
AVSDRGSMFDPSAVFYMDKIVTGADGIGVVDISQSIGDNIRELAKAKGKQPEDIRVAVLD
RPRHAQLIEEIRAAGAGTRLLLDGDVAGGINAARYDSRIDMCVGIGGTPEGIITACAVKA
LGGLIQGKLMPKDDAERERALAAGHDLDRVLGANDLVRGDNTYFVATGVTHGELVDGVQR
KGPIIRTESLVLRSRSGTIRRVEADHLAAKWL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggaggatccagtgacccagcctgaaaccggctcccactatctgcagcccgaccgcaac
ctcgccatggagctcgtaagagcgacggaggccgccgcgatccgggcggcgccgttcatc
gggcgaggcgacaagaacgccgccgacggcgcagcggtcgacgccatgcgcgccttcctc
ggcaccgtcaacttcgacggcgtggtcgtcatcggcgagggcgagaaggatgaagcgccc
atgctgttcaacggcgagcatgtcggcaacggccgcggcccgtcctgcgacatcgccgtc
gacccgatcgacggcacgagcctcaccgccgcaggccgccagaacgccctctccgtcatc
gccgtgtccgaccgcggcagcatgttcgacccgtccgcggtgttctacatggacaagatc
gtcaccggcgccgacggcatcggtgtcgtcgacatcagccagtccatcggcgacaacatc
cgcgagctcgcgaaggccaagggcaagcagcccgaggacatccgcgtcgccgtcctcgac
cgaccgcgccacgcgcagctcatcgaggagatccgcgcggcgggtgccgggacgcgtctg
ctgctcgacggcgacgtcgcgggtggcatcaacgccgcgcgctacgactcgcggatcgac
atgtgcgtcggcatcggcggcacgcctgagggcatcatcaccgcgtgtgcggtgaaggcg
ctcggcgggctcatccagggcaagctcatgccgaaggacgacgccgagcgtgagcgtgcg
ctcgcggccggtcacgacctcgaccgcgtcctcggcgcgaacgacctcgtccgcggcgac
aacacgtacttcgtcgcgacgggcgtcacccacggtgaactcgtcgacggtgtgcagcgc
aaggggccgatcatccgcaccgagagcctcgtgctgcggtcgcgttccggcaccatccgt
cgcgtcgaggcggaccacctcgcggcgaagtggctgtag

KEGG   Plantibacter sp. PA-3-X8: EAO79_15765Help
Entry
EAO79_15765       CDS       T05731                                 

Definition
(GenBank) ATP-dependent 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00010  Glycolysis / Gluconeogenesis
plap00030  Pentose phosphate pathway
plap00051  Fructose and mannose metabolism
plap00052  Galactose metabolism
plap00680  Methane metabolism
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
plap01120  Microbial metabolism in diverse environments
plap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAO79_15765
   00030 Pentose phosphate pathway
    EAO79_15765
   00051 Fructose and mannose metabolism
    EAO79_15765
   00052 Galactose metabolism
    EAO79_15765
  09102 Energy metabolism
   00680 Methane metabolism
    EAO79_15765
Enzymes [BR:plap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EAO79_15765
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     EAO79_15765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK GDE_C NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AZH84182
UniProt: A0A3G8VGG7
Position
complement(3337693..3338721)
Genome map
AA seq 342 aa AA seqDB search
MRIGVLTSGGDCPGLNAVIRGAVLKGTKIHNQEFIGIRDGWRGVVEGLTMPLDRHSVRGL
AKQGGTILGTSRTNPFEGPHGGPENVQHTMDRLGIDALIAIGGEGTLAAAKRLTDAGLKI
VGVPKTIDNDLDATDYSFGFDTAVEIATEAIDRLRTTGESHKRCMVIEVMGRHVGWIALH
AGMAAGAHAILIPEQPQSIEQICEWADSVYQRGRAPIIVVSEGFTLDTMETAHSEKGLDA
FNRPRLGGIADVLAPEIERRTGIESRATVLGHLQRGGVPSAYDRVLATRLGMAAIDSVMA
GDWGTMIALRGTELVNCRFEEALGKLKTVPQERYDEAAILFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggtgtgctcacgagcggcggcgactgccccggcctgaacgcggtcatccga
ggagcggtcctcaaagggacgaagatccacaaccaggagttcatcggcatccgcgacggc
tggcgaggagtcgtcgagggcctgacgatgccgctcgaccgccacagcgtgcgtggtctc
gccaagcagggtggcaccatcctcggcacgagccgcaccaacccgttcgaaggaccgcac
ggcggcccggagaacgtccagcacaccatggaccggctcggcatcgacgcgctcatcgcc
atcggcggagagggcacgctcgccgcggcgaagcggctgaccgacgccggcctcaagatc
gtcggcgtcccgaagacgatcgacaacgatctcgacgccaccgactactccttcggcttc
gacaccgccgtcgagatcgcgaccgaggccatcgaccgtctccggacgacgggcgagtcc
cacaagcggtgcatggtcatcgaggtcatgggccggcacgtcggctggatcgccctgcac
gccggtatggcggcgggtgcccacgccatcctcatcccggaacagccgcagtcgatcgag
cagatctgcgagtgggcggacagcgtctaccagcgcggtcgcgccccgatcatcgtcgtg
tccgagggcttcacgctcgacaccatggagaccgcgcactccgagaagggactcgacgcg
ttcaaccgtccccgtctcggcggcatcgccgacgtgctcgcacccgagatcgagcgccgc
acgggcatcgagtcccgcgcgaccgtgctcggccacctgcagcgcggtggcgtcccgagc
gcctacgaccgcgtgctcgccacccgcctcggtatggccgccatcgactccgtcatggcc
ggcgactggggcacgatgatcgcactccgcggcaccgaactcgtcaactgccgcttcgaa
gaggcgctcggcaagctgaagaccgtgccgcaggagcgctacgacgaagcggcgatcctc
ttcggctag

DBGET integrated database retrieval system