KEGG   Plantibacter sp. PA-3-X8: EAO79_14170Help
Entry
EAO79_14170       CDS       T05731                                 

Definition
(GenBank) protoheme IX farnesyltransferase
  KO
K02257  heme o synthase [EC:2.5.1.141]
Organism
plap  Plantibacter sp. PA-3-X8
Pathway
plap00190  Oxidative phosphorylation
plap00860  Porphyrin and chlorophyll metabolism
plap01100  Metabolic pathways
plap01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plap00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EAO79_14170
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    EAO79_14170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:plap01006]
    EAO79_14170
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:plap03029]
    EAO79_14170
Enzymes [BR:plap01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.141  heme o synthase
     EAO79_14170
Prenyltransferases [BR:plap01006]
 Compound prenylation
  Protoheme farnesyltransferase
   EAO79_14170
Mitochondrial biogenesis [BR:plap03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    EAO79_14170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UbiA
Motif
Other DBs
NCBI-ProteinID: AZH83907
UniProt: A0A3G8VGP1
Position
3000300..3001220
Genome map
AA seq 306 aa AA seqDB search
MDVAVAERVSSPKLGFRRKAKAYIALTKPRVMELLLVTTIPVMILAKGGLPDWWLVIATV
IGGSLSAGSAAAFNCYIDRDIDAVMDRTKKRPLVTGELTPREALVFAWTLGVVSTVWLLA
TTNWLAAALSVGAILFYVFVYTLWLKRRTQQNIIWGGIAGCFPVVIGWAAVTGSLSWAPI
ILFAVVFLWTPPHYWPLSMKYRSDYQAVGVPMLAVVRGRAQVGLQVILYAWATVVCSLLL
IPVADMGLLYSAVALLSGGWFVYETHRLYNLAIRHEHVSPMRVFHGSITYLTLLFLAVGI
DPLLPF
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgctgtagcagaacgtgtgtcgagccccaagctcggtttccgacgcaaggcg
aaggcgtacatcgccctcaccaagccgcgggtcatggaactgctgctcgtgacgacgatc
cccgtcatgatcctcgcgaagggcggtctgcccgactggtggctcgtgatcgcgaccgtc
atcggcgggtcgttgagcgccggctccgcggcggcgttcaactgctacatcgaccgcgac
atcgacgcggtcatggaccgcacgaagaagcgccccctcgtgaccggcgagctcacgccc
cgtgaggcactcgtgttcgcgtggacgctcggcgtcgtctcgacggtctggctcctcgcc
accaccaactggctggcggccgcactgtccgtcggcgcgatcctcttctacgtcttcgtg
tacacgctgtggctgaagcgacgcacccagcagaacatcatctggggtggcatcgcgggc
tgcttccccgtcgtcatcggctgggccgccgtcaccggttcgctctcgtgggcaccgatc
atcctcttcgcggtcgtgttcctctggacgccgccccactactggccgctgtccatgaag
taccgcagtgattaccaggccgtcggcgtgccgatgctcgccgtcgtccgcggtcgcgcg
caggtcggcctccaggtcatcctgtacgcgtgggcgacggtcgtctgctcgctcctgctc
atcccggtggccgacatggggctgctgtacagcgccgtcgccctcctgtccggcggctgg
ttcgtctacgagacccaccgcctctacaacctcgcgatccgccacgagcacgtctcgccg
atgcgtgtcttccacggttcgatcacctacctgaccctcctgttcctcgccgtcggcatc
gacccgctgctcccgttctga

DBGET integrated database retrieval system