KEGG   Plantactinospora sp. BB1: C6W10_22065Help
Entry
C6W10_22065       CDS       T05391                                 

Definition
(GenBank) cobyric acid synthase CobQ
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
plat  Plantactinospora sp. BB1
Pathway
plat00860  Porphyrin and chlorophyll metabolism
plat01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plat00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    C6W10_22065
Enzymes [BR:plat01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     C6W10_22065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 DJ-1_PfpI SNO GATase Peptidase_S51 CAP_N Mito_fiss_reg
Motif
Other DBs
NCBI-ProteinID: AVT41710
UniProt: A0A2R4FW30
Position
complement(5079261..5081009)
Genome map
AA seq 582 aa AA seqDB search
MRAARGGLLVAGTTSDAGKSVLTAGICRWLHRQGVRVAPFKAQNMSNNSAVVIGPDGRGG
EIGRAQAMQAAACGVSPDLRFNPVLLKPGSDRSSQVVLLGRAVDTVTAGNFRALRPRLAT
AAFEALAELRAEYDVVVCEGAGSPTEINLRDTDYANMGLARHARLPTIVVGDIDRGGVFA
SMFGTVALLDAADQELVAGFVVNKFRGDLDLLRPGLDMLNRLTGRPTYGVLPWHVDLWLD
AEDSLAYGRVLGRPAPPKGGEWLDVAVVRLPRVSNATDVEALATEPGVRVRLTVEPAEVA
AADLVVLPGTKSTVADLEWLRRTGLADVVHAHVAAGRPLLGICGGFQMLARSIDDEVESG
RGRVAGLGLLPIEITFGAAKTVTRSAGTAFGSVPVQGYEIHHGYVSNADPAPSPLIRSSD
GRPEGAALGHLFGTHWHGAFTSDGFRRRFLTEVARLAGRHGFQVAPDTSFAAARERSLDL
LGDLVEEHLDTAALWRLVEQGPPAGLPFVPPGAPPVPAPAPPPPLLPPPPPPPPAHPHPP
AGSCTNKQQPRKPREKKRKQQATRTTRESSKKQNNTRRDRAN
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggccgcgcgcggtggactgctggtcgcgggcaccacctcggacgccggcaagagt
gtgctcaccgccggtatctgccgctggctgcaccgccagggggtcagggtggcgccgttc
aaggcccagaacatgtccaacaactcggcggtggtgatcgggccggacgggcggggcggg
gagatcggtcgagcccaggccatgcaggccgctgcctgcggagtgtcgccggacctgcgg
ttcaatccggtactgctgaagcccggtagtgaccggtcgagccaggtggtgctgctcggc
cgggcggtggacaccgtcaccgccggcaacttccgtgccctccgtccccggctggcgacg
gctgccttcgaggcgctcgccgagctgcgcgcggagtacgacgtggtggtctgcgaggga
gcgggcagccccacggagatcaaccttcgggacaccgactacgccaacatgggcctggcc
cggcacgcccggctgcccacgatcgtggtcggcgacatcgaccggggcggcgtattcgcg
tcgatgttcggcaccgtggccctgctggacgccgccgaccaggaactcgtggccggcttc
gtggtcaacaagttccggggcgacctggacctgctccgtcccggcctcgacatgttgaac
cggctcaccggacggccgacgtacggggtgctgccgtggcacgtcgacctgtggctggac
gccgaggactcgctcgcctacgggcgggtgctcggccgcccggcgccgccgaagggcggt
gagtggctggacgtggcggtggtccggctgccccgggtctccaacgccaccgacgtggag
gcgctcgccaccgagccgggggtacgggtccggttgaccgtcgagccggccgaggtggcc
gccgccgatctcgtcgtactgccgggcacgaagtcgacggtggcggacctggagtggctg
cgccgtaccgggctggccgacgtggtgcacgcacacgtggccgccggtcgaccgctgctc
gggatctgcggcggtttccagatgctcgcccgcagcatcgacgacgaggtggagagtggg
cgtggccgggtcgccggcctcggcctgctacccatcgagatcactttcggcgccgccaag
accgtgacgcgctcggcgggcacggcgttcgggtcggtcccggtccagggctacgagatc
caccacgggtacgtctccaacgccgacccggcaccgtcgccgctgatccgctcttcggac
ggccgaccggagggagcggcgctcggtcacctcttcggcacccactggcacggcgccttc
acctcggacgggttccgtcggcgcttcctcaccgaggtggcccgactggccggccggcac
ggcttccaggtcgccccggacacctcgttcgcggcggcccgggaacgcagcctggacctc
ctcggcgacctggtggaggagcacctcgacaccgccgccctgtggcggctcgtcgagcag
gggccaccggccgggctaccgttcgtcccgccgggcgcaccgccggtccccgcccccgcc
ccccccccccccctcctcccccccccccccccccccccccccgcccacccccaccccccc
gctggctcatgcacaaacaaacagcagccaagaaaaccaagagaaaaaaagagaaaacaa
caagcgacaagaacgacacgggaaagctcgaagaagcagaacaacactaggagagacaga
gcaaactaa

DBGET integrated database retrieval system