KEGG   Plantactinospora sp. BB1: C6W10_25555Help
Entry
C6W10_25555       CDS       T05391                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
plat  Plantactinospora sp. BB1
Pathway
plat00350  Tyrosine metabolism
plat00360  Phenylalanine metabolism
plat00380  Tryptophan metabolism
plat01100  Metabolic pathways
plat01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:plat00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    C6W10_25555
   00360 Phenylalanine metabolism
    C6W10_25555
   00380 Tryptophan metabolism
    C6W10_25555
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:plat04147]
    C6W10_25555
Enzymes [BR:plat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     C6W10_25555
    4.1.1.105  L-tryptophan decarboxylase
     C6W10_25555
Exosome [BR:plat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C6W10_25555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC SepSecS DegT_DnrJ_EryC1 Beta_elim_lyase Aminotran_5 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AVT41813
UniProt: A0A2R4FWB0
Position
5850590..5852035
Genome map
AA seq 481 aa AA seqDB search
MTPDEFRRHGHQVVDWIADYWSTLDRRPVTSADPPGTVAARLPTGPPERGEPFDRLLADL
DTVITPGLTHWQHPRFFGYFPANTSGPSVLGDLVGAGLGVQGMLWSTGPACTEVETVVLD
WLAELLDLPARFRSTGSGGGVIQDSASSAILIAVLAALHRAGGGRWRGHGVRRAYRVYTS
TQGHSAIEKAVRIAGLGDAGLRTVAVDPQTLAMDPAALRTAIEADRAAGLVPAAVVATIG
TTSTNAVDPIPAIGELCREYGLWLHVDAAYAGAAAVCPELRHTHAGLQHADSYCFDPHKW
LLTGFDCDAFWVADRAELVEALTVLPEYLRNAATDSGEVLDYRDWQVPLGRRFRALKLWF
VLRWYGAEGLRAHIRETIGLAGWFAEQVRADRRFELVAPGPFALVCFRLRSTGDAAADDE
ANAELLARVNATGRAYLTHTRVAGRYTLRLVPGSPYTRQEHVAQTWRLMGETAAALPDRR
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaccccggacgagttccgccggcacgggcaccaggtcgtcgactggatcgccgactac
tggtccaccctggaccggcggccggtcacctccgccgacccgcccggcacggtcgccgcc
cggctgccgaccggcccgcccgagcggggtgagccgttcgaccggctcctcgccgacctg
gacacggtgatcacgcccggtctcacccactggcagcatccccggttcttcggctacttc
ccggcgaacacctcggggccgagcgtgctcggcgacctggtcggcgccggcctcggggtg
cagggcatgctctggtcgaccggtccggcctgcaccgaggtcgagacggtggtgctggac
tggctggcggaactgctcgacctgccggcccggttccggtccaccggctccggcggcggg
gtgatccaggactcggcctcctcggccatcctgatcgccgtactcgccgcgctgcaccgg
gccggcggcgggcggtggcgggggcacggggtgcggcgggcgtaccgggtatacacctcc
acccagggacattcggcgatcgagaaggcggtccggatcgccggactcggcgacgcgggg
ctgcgtacggtcgcggtcgatccgcagaccctggcgatggacccggcggcgctgcgtacg
gcgatcgaggcggaccgggccgccgggctggtcccggcggcggtggtggcgacgatcggc
accacctccaccaacgcggtcgacccgatcccggcgatcggcgagctgtgccgggagtac
ggcctctggctgcacgtcgacgccgcgtacgccggtgccgcggcggtctgcccggaactg
cgccacacccacgccgggctgcagcacgccgactcgtactgcttcgacccgcacaagtgg
ctgctcaccggcttcgactgcgacgcgttctgggttgcggaccgggcggagctggtcgag
gcgctgaccgtgctgccggagtacctgcgcaacgcggcgaccgactccggcgaggtgctc
gactaccgcgactggcaggtgccgctcgggcggcggttccgggccctgaaactctggttc
gtgctgcgctggtacggcgccgaggggctgcgggcgcacatccgggagacgatcgggctg
gccggctggttcgccgagcaggtccgggccgaccggcggttcgaactggtcgcgccgggc
ccgttcgcgctggtctgcttccggctgcggtcgaccggtgacgctgccgccgacgacgag
gccaacgccgaactgctggcccgggtgaacgcgaccggccgggcgtacctgacgcacacc
cgggtggcggggcgttacacgctgcggctggtgcccggttcgccgtacacccggcaggag
cacgtggcgcagacctggcggctgatgggcgagaccgcggcggcgctgccggatcggcgg
aactga

DBGET integrated database retrieval system