KEGG   Plantactinospora sp. BB1: C6W10_30470Help
Entry
C6W10_30470       CDS       T05391                                 

Definition
(GenBank) hypothetical protein
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
plat  Plantactinospora sp. BB1
Pathway
plat00500  Starch and sucrose metabolism
plat01100  Metabolic pathways
plat02020  Two-component system
Brite
KEGG Orthology (KO) [BR:plat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C6W10_30470
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    C6W10_30470
Enzymes [BR:plat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     C6W10_30470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-ProteinID: AVT40046
UniProt: A0A2R4FRD2
Position
complement(6977864..6979228)
Genome map
AA seq 454 aa AA seqDB search
MDTNPLSRGKWSPARRGLAAAAAFSLVTGLLLAPAGQASAAPRVDNPYEGATVYVNPDWA
AKATASGGAAIADQPTGVWMDRRAAITGTEGARGLREHLDTAVEQGADLIQIVIYNLPGR
DCAALASNGELGPDDIDVYKSEYIDPIVEIMGDPAYAELRIVNIIEIDSLPNLITNVGSR
ETATPECDEMLANGNYVEGVGYALAQLGSLPNTYNYIDIGHHGWLGWDDNFGPAAQLFHE
AATAAGATVDDVHGFISNTANYGVLREEFFDANTVVGGRPVREASTFVDWNRYVDELSYA
QAYRDELISVGFNDDIGMLIDTSRNGWGGPDRPTRASSSTDPEIFVNESRIDRRIHLGNW
CNQAGAGIGERPTAAPEDGIDAYVWIKPPGESDGASREIQNDEGKGFDRMCDPTYEGNPR
NQYNMSGALPDAPLSGHWFEAQFQELLRNAYPPL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaaccccttatcccggggtaagtggtcgccggcccgtcgcgggctggccgcc
gccgcggccttctccctcgtcaccggtctgctgctggccccggccggccaggccagcgcc
gctcccagggtggacaacccctacgagggggccaccgtctacgtgaacccggactgggcc
gcgaaggccaccgccagtggcggtgcggcgatcgccgaccagcccaccggcgtctggatg
gaccgccgcgccgccatcaccggcaccgaaggcgcccgtggcctgcgcgagcacctggac
acggcggtggagcagggcgccgacctgatccagatcgtcatctacaacctgcccggccgg
gactgcgccgcgctggcctccaacggcgaactgggtccggacgacatcgacgtctacaag
tccgagtacatcgacccgatcgtcgagatcatgggcgatcccgcctacgccgaactgcgg
atcgtcaacatcatcgaaatcgactcgctgccgaacctgatcaccaacgtgggctcgcgg
gaaaccgcgacgccggagtgcgacgagatgctggccaacggcaactacgtcgagggcgtc
ggttacgcgctggcccagctcggatcactgccgaacacctacaactacatcgacatcggc
caccacggctggctcggctgggacgacaacttcggcccggccgcacaactcttccacgag
gcggcgaccgctgccggtgccaccgtggacgacgtgcacggcttcatcagcaacaccgcc
aactacggcgtactgcgcgaggagttcttcgacgccaacaccgtggtcggcggccggccg
gtccgcgaggccagcaccttcgtcgactggaaccggtacgtcgacgagctgtcctacgcc
caggcgtaccgggacgagctgatctcggtcggcttcaacgacgacatcgggatgctgatc
gacacctcccgcaacggctggggcggcccggaccggccgacccgggccagcagctcgacc
gacccggagatcttcgtcaacgagtcgcgcatcgaccgccggatccacctcggcaactgg
tgcaaccaggccggtgccggcatcggcgagcggccgaccgctgctccggaggacggcatc
gacgcgtacgtctggatcaagcccccgggcgagtcggacggtgccagccgggagatccag
aacgacgagggcaagggcttcgaccggatgtgcgacccgacgtacgagggcaacccgcgc
aaccagtacaacatgtccggtgccctgccggacgccccgctctccgggcactggttcgag
gcccagttccaggaactgctccgcaacgcctacccgccgctgtga

DBGET integrated database retrieval system