KEGG   Plantactinospora sp. BB1: C6W10_33040Help
Entry
C6W10_33040       CDS       T05391                                 

Definition
(GenBank) glycosyltransferase family 1 protein
  KO
K16150  glycogen synthase [EC:2.4.1.11]
Organism
plat  Plantactinospora sp. BB1
Pathway
plat00500  Starch and sucrose metabolism
plat01100  Metabolic pathways
Module
plat_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:plat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    C6W10_33040
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:plat01003]
    C6W10_33040
Enzymes [BR:plat01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     C6W10_33040
Glycosyltransferases [BR:plat01003]
 Polysaccharide
  Storage polysaccharide
   C6W10_33040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4 Glyco_transf_5 Glyco_trans_1_2 Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: AVT40482
UniProt: A0A2R4FSH5
Position
7540991..7542307
Genome map
AA seq 438 aa AA seqDB search
MSPNAEVVNFPAARPRKVLILSWEYPPVLVGGLGRHVHALATALAAAGHQVTVVTRHGEG
APVEAYVDGVHVLRAPEDPVGFPLATPSLLAWTMAFNHTLTRTALRAARTADYDVIHAHD
WLVAHTAINLADHLDIPLVTTIHATEAGRHQGWLPDEMNRTIHSVEHWLGHESHRVITCS
GYMRDQVKALFGLPDGHVEVVPNGVDDRAWSAQPRAVAAARRRYAGAGPLVGFAGRLVYE
KGVQHLVHAVPRLRERHPELRVVIAGDGPYRQELQDQAHRLGLDRSVRFAGFMTERQLPA
VLAATDATVVPSLYEPFGMVALEAAAAGAPLAVAATGGLAEIVEPGVTGVTFPHSDPDAL
AGAVDSLLGDEVFARRVARRARTMVAERYGWASIAARTAAVYASAANAGPAPRTRAGGGT
GRIVVPEGNLLALDGAAC
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccgaacgccgaggtcgtcaacttccccgcggcccgcccgcgcaaggtactcatc
ctctcctgggagtacccgccggtgctggtcggcgggctcggccggcacgtgcacgcgctc
gccaccgcgctcgccgccgccgggcaccaggtcacggtggtcacccggcacggcgagggc
gcaccggtcgaggcgtacgtcgacggcgtgcacgtgctgcgcgccccggaggacccggtc
ggcttcccgctggccaccccgagcctgctggcctggacgatggcgttcaaccacacgctg
acccggaccgccctgcgggccgcccggaccgccgactacgacgtgatccacgcccacgac
tggctggtcgcgcacaccgcgatcaacctcgccgaccacctggacatcccgctggtcacc
acgatccacgccaccgaggcgggccggcaccagggctggttgccggacgagatgaaccgg
accatccactcggtcgagcactggctcggccacgagtcgcaccgggtgatcacctgctcc
ggctacatgcgcgaccaggtgaaggcgctcttcgggctcccggacgggcacgtcgaggtg
gtgccgaacggggtcgacgaccgggcctggtcggcgcagccccgggcggtcgccgccgcc
cgcaggcggtacgccggtgccggcccgctggtcggcttcgccgggcggctggtctacgag
aagggcgtacagcacctggtgcacgccgtaccgagactgcgggagcggcacccggagctg
cgggtggtgatcgccggggacggcccgtaccggcaggagttgcaggaccaggcgcaccgg
ctcgggctggaccggagcgtacgcttcgccgggttcatgaccgagcggcagttgccggcg
gtgctggccgccaccgacgccacggtggtgccgagcctctacgagccgttcgggatggtc
gccctggaggcggccgccgccggtgccccgctggcggtcgccgccaccggcgggctggcc
gagatcgtcgagccgggggtgaccggggtgaccttcccgcacagcgacccggacgcgctg
gccggcgccgtcgactcgctcctcggcgacgaggtcttcgcccgccgggtggcccgacgg
gcccgcaccatggtcgccgaacggtacggctgggcgagcatcgccgcccggaccgccgcc
gtctacgccagcgcggcgaacgccggcccggcgccgcggacccgggccgggggcgggacg
gggcggatcgtcgtacccgaggggaacctgctggccctcgacggcgccgcctgctga

DBGET integrated database retrieval system