KEGG   Candidatus Portiera aleyrodidarum TV-BCN: PTV_130Help
Entry
PTV_130           CDS       T03736                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
plb  Candidatus Portiera aleyrodidarum TV-BCN
Pathway
plb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:plb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    PTV_130 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:plb03011]
    PTV_130 (rplV)
Ribosome [BR:plb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    PTV_130 (rplV)
  Bacteria
    PTV_130 (rplV)
  Archaea
    PTV_130 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CEI59093
Position
I:complement(122375..122716)
Genome map
AA seq 113 aa AA seqDB search
MEEVSAKLCGVRLSAQKARLVANQIRGKSVYRALEILKFSSKKAADIIKKTLKSVMYNAK
KNKGMNIEKLIISGIWINEGKSLKRNLPRAKGRTDSIMKRTCHINIRVKEKNR
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagtaagtgcaaaattatgtggtgtgcgattatcagcacaaaaagctagatta
gtagctaatcaaattagaggaaaatcagtatatagagcattagaaattttaaaattttca
tcaaaaaaagcagcagatataataaagaaaacattaaaatcagtaatgtataatgcaaaa
aaaaataagggtatgaatattgaaaaattaataatatctggtatttggataaatgaaggg
aaaagtttaaaaagaaatttaccaagagctaaaggtcgtactgatagtattatgaaacgt
acttgtcatataaatataagagtaaaagaaaaaaataggtag

DBGET integrated database retrieval system