KEGG   Candidatus Portiera aleyrodidarum TV: PalTV_171Help
Entry
PalTV_171         CDS       T02521                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
pld  Candidatus Portiera aleyrodidarum TV
Pathway
pld00030  Pentose phosphate pathway
pld00480  Glutathione metabolism
pld01100  Metabolic pathways
pld01110  Biosynthesis of secondary metabolites
pld01120  Microbial metabolism in diverse environments
pld01130  Biosynthesis of antibiotics
pld01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pld00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PalTV_171 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PalTV_171 (gnd)
Enzymes [BR:pld01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     PalTV_171 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     PalTV_171 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 6PGD F420_oxidored 2-Hacid_dh_C TrkA_N ApbA 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AGI27159
UniProt: M4X7U5
Position
complement(158036..158962)
Genome map
AA seq 308 aa AA seqDB search
MIIGIIGLGKMGGNISIRLLKNKYTCYVFDKNITNIKQIEKKGGIGVKSLKDLVLSLSNP
RTIWLMLPAGEITEKIILKIINYMEKGDTIIDGSNGYFKKDIQRSEKLVIRGINYIDVGV
SGGIWGLKRGFCMMIGGNKKMFEKKHKIFCILSSEKNKCYMYCGKIGSGHFVKMIHNGIE
YGMMQSYAEGFDIMNNINKKHVLYKHRYQLNLYYISEIWRRGSVIESWLLDLISISLAKD
VNLKEFSGKVKDSGEVRWIVKTALEESIPVEVLTTSLYVRFKSRMNNRYGEKLLSAMRKQ
FGGHVEEK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgataataggtattattggtttaggaaaaatgggaggaaatatttcgataagattatta
aaaaataaatatacttgttatgtttttgataaaaatataacgaatataaaacaaatagaa
aaaaaaggaggaataggggtaaaatcattaaaagacttagttttaagtttatctaatcct
agaaccatttggttaatgttaccggctggcgaaataacggaaaaaataattttaaaaata
ataaactatatggaaaagggagatactataatagatggtagtaatggatattttaaaaaa
gatatccaaagatctgaaaaactagttataagaggaataaattatatagatgtaggcgtg
tcaggtggaatatggggtttaaaaagaggattttgtatgatgataggagggaataaaaaa
atgtttgaaaaaaaacataaaattttttgtatattatcttcagaaaaaaataaatgttat
atgtattgtggaaaaatagggtcaggacattttgttaaaatgatacataatggtatagaa
tatggaatgatgcaatcttatgcagaagggtttgatataatgaacaatatcaataaaaaa
catgtattatataaacacaggtatcaattaaatttatattatatttcggaaatatggcgt
agaggaagtgtaatagagtcatggttattagatttaatttctatatcattagcaaaagat
gttaatcttaaagaatttagtggcaaagtgaaggattcaggtgaagttagatggatagta
aaaacagctttagaagaatcaataccagtagaggtattaacaacatcattatatgttaga
tttaagtcgagaatgaacaatagatatggtgagaaattgctatcagcaatgcgtaaacag
tttggaggacatgtagaagaaaaatga

DBGET integrated database retrieval system