KEGG   Paenibacillus lentus: EIM92_11330Help
Entry
EIM92_11330       CDS       T05914                                 

Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
plen  Paenibacillus lentus
Pathway
plen00561  Glycerolipid metabolism
plen00640  Propanoate metabolism
plen01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:plen00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EIM92_11330
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    EIM92_11330
Enzymes [BR:plen01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     EIM92_11330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-ProteinID: AZK46674
UniProt: A0A3S8RV05
Position
2540356..2541492
Genome map
AA seq 378 aa AA seqDB search
MRRAFISPAKYVQGEDELLNLGYYVRTFGESALLIAHPEDVARVKAKLDATAGKFNITFI
ESGFQGECSRQEVARLQAIAKEQRCACTIGLGGGKAIDTAKCVAEGEALIIVPTIAATDA
PTSHSAVLYTPEGAFDDYAYFKQSPSVVMIDTTVIANAPTRFLVAGMGDAISTYFEARAT
ARSYSNVNAGLPNGVREGICGDAKGTKTALALAKLCYETLLEDGLKAKLSCDRNVVTPAL
ENIVEANILLSGLGFESGGLAAAHAIHNGLTSLEGTHSYYHGEKVAFSTIAQLVLENADQ
DELDEVLSFCASVGLPICLADLGVDSISNEELQEVAQKACIPEESIHSMPFPITVEAVAA
AIMVADQIGREFKKRKEA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgagaagagcctttattagcccggcaaaatatgtccaaggtgaggacgaactacttaac
ttgggttactatgtaagaacttttggggagtccgcgctactgattgcccatcccgaggat
gtggcacgagtgaaagcgaagctggatgcaactgcaggcaagtttaatatcacttttatt
gaaagcggtttccaaggtgaatgctccagacaagaagtcgcacggctgcaagctattgcc
aaggagcaacgctgtgcttgtacgattggactcggcggagggaaagcgattgataccgcg
aaatgtgtggctgaaggggaggccctgatcatcgtcccgacgatagctgcaacagatgcg
ccgacaagccattcggctgtgctgtatacgccggagggagcctttgatgattatgcttat
tttaaacaaagccctagcgtggttatgattgatacgacggtgatcgcgaatgcgccaacc
cgtttccttgtagctggtatgggggacgcgatttctacttattttgaggcgagagctacg
gcgagatcctactctaacgtaaacgccggattaccaaacggtgtacgggaggggatatgc
ggggatgccaaaggaaccaagacagcactagccttggcgaaattatgttacgaaacgtta
ttggaagacggtctcaaggccaaactatcctgtgatcggaatgtcgtcacgcctgcattg
gagaacattgttgaagccaatattctgctatccggcctaggattcgagagcgggggctta
gcggcagcgcatgcgatccataacggattaacctcgcttgaggggacacatagctattat
catggagaaaaagtagccttcagtacgatcgcacagttggttcttgaaaatgcagatcag
gacgaactcgatgaagtactctcgttctgcgcatcggtcggcctgccgatttgcctggct
gacttgggggtagacagcatttcgaacgaagaattgcaggaagtagcccagaaggcctgt
atcccggaagaatcgattcattcgatgccattcccgattacggtggaagcggtagcagca
gcgattatggtcgcagatcaaattgggcgtgaattcaaaaagcgcaaggaggcataa

DBGET integrated database retrieval system