KEGG   Pleomorphomonas sp. SM30: OHA_1_00373Help
Entry
OHA_1_00373       CDS       T05766                                 

Gene name
cysS
Definition
(GenBank) cysteine-tRNA ligase
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    OHA_1_00373 (cysS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pleo01007]
    OHA_1_00373 (cysS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pleo03016]
    OHA_1_00373 (cysS)
Enzymes [BR:pleo01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     OHA_1_00373 (cysS)
Amino acid related enzymes [BR:pleo01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   OHA_1_00373 (cysS)
Transfer RNA biogenesis [BR:pleo03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    OHA_1_00373 (cysS)
 Prokaryotic Type
    OHA_1_00373 (cysS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1f tRNA-synt_1g tRNA-synt_1 DALR_2
Motif
Other DBs
NCBI-ProteinID: BBE70806
UniProt: A0A2Z6HTQ2
Position
1:393809..395215
Genome map
AA seq 468 aa AA seqDB search
MTLKLYNTLTRAKEDFVPIDPANVRMYVCGPTVYDFAHIGNARPVIVFDVLYRLLRHLYG
VEHVRYVRNVTDVDDKINARAARDYPGVPPVEAIFDLTTKTYSQFEADVADLLCLKPSAT
PRATLHVAEMIELIESLIARGHAYAAEGHVLFHVPSMPAYGRLSRRSLDDMIAGARVDVA
PYKRDPMDFVLWKPSSADEPGWDSLWGRGRPGWHIECSAMAYAELIRPFGGGFTCADPTR
NVFDIHGGGIDLVFPHHENEIAQTCCALGTERMANVWMHNGFLQVEGEKMSKSLGNFFTI
RELLDDWPGEVLRLAMLKTHYRQPIDFTVKALEEAWRTLDDWYAIAGAVEPGAPDACVLE
ALADDLNTARVVAELHGLRSDPAALAGSLRLLGFLADTPAAWAARRPAAAVDTGAVEALV
TARLAARKARDFKESDRLRDELAALGVVLKDGKDPATGEPVTTWEVKR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
gtgacgctgaagctctacaacacgctgacgcgggcgaaggaggacttcgtcccgatcgat
ccggccaacgtccggatgtacgtctgcgggccgacggtctacgacttcgcccacatcggc
aacgcccggccggtgatcgtgttcgacgtgctgtaccgcctgctgcgccatctctacggc
gtcgagcacgtacgctacgtccgcaacgtcaccgacgtcgacgacaagatcaacgcccgc
gccgcccgcgactatcctggcgtgccgccggtcgaggcgatcttcgacctgaccacgaag
acctatagccagttcgaggccgacgtcgccgatctcctctgcctgaagccgagcgccacc
ccgcgcgcgacgctgcacgtcgccgagatgatcgagctgatcgagagcctgatcgcgcgc
ggccacgcctacgccgccgagggccacgtgctgttccacgtgccgtcgatgccggcctac
ggccggctgtcgcgccgctcgctcgacgacatgatcgccggcgcccgcgtcgacgtcgcg
ccctacaagcgcgacccgatggatttcgtgctgtggaagccgtcgtcggccgacgagccg
ggctgggacagtctctggggacgcggccggccgggctggcacatcgagtgctccgcgatg
gcctacgccgagctgatccgccccttcggcggcggcttcacctgcgcggacccgacgcgg
aacgtgttcgacatccacggcggcggtatcgacctcgtgttcccgcaccacgagaacgag
atcgcccagacctgctgcgccctcggcaccgagcgcatggccaacgtctggatgcacaac
ggcttcctccaggtcgagggggagaagatgtcgaagtcgctcggcaacttcttcaccatc
cgcgagctgctcgacgactggccgggcgaggtgctgcgcctcgccatgctgaagacccat
taccgccagccgatcgacttcacggtcaaggcgctggaggaggcctggcgcacgctcgac
gactggtacgcgatcgccggcgcggtcgagccgggcgcgcccgacgcctgcgtgctcgag
gcgcttgccgacgacctcaacaccgcgcgcgtcgtcgccgaactgcacgggctgcgctcg
gatccggccgcgctcgccggttcgctgcgtctgctcggcttcctcgccgacacccccgcc
gcctgggccgcccgccggcccgccgccgccgtcgacaccggcgcggtggaggcgctcgtc
accgcccgcctcgccgcccgcaaggcgcgcgacttcaaggaatccgaccgcctgcgcgac
gaactcgccgccctcggcgtggttctgaaggacggcaaggacccggcgaccggcgagccg
gtgacgacgtgggaggtgaagcggtga

DBGET integrated database retrieval system