KEGG   Pleomorphomonas sp. SM30: OHA_1_01521Help
Entry
OHA_1_01521       CDS       T05766                                 

Gene name
yjmD
Definition
(GenBank) putative zinc-type alcohol dehydrogenase-like protein YjmD
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    OHA_1_01521 (yjmD)
Enzymes [BR:pleo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     OHA_1_01521 (yjmD)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     OHA_1_01521 (yjmD)
    1.1.1.-  
     OHA_1_01521 (yjmD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: BBE71936
UniProt: A0A2Z6HWS8
Position
1:1643294..1644283
Genome map
AA seq 329 aa AA seqDB search
MKAVRLHAAGDLRVEDLPEPGAPGPGEVSLKVLAAGICGSDVHNFRTGQWLTGTPRVAGH
EFSAEVVAVGGGVAGLAPGDRVVADSRFWCGDCDACRAGRRNLCRRLGFVGEVCDGGFAP
FTVLPARLVEKVPAGTDPVAAAMAEPLAVALHAIRRLPVPAGAPVLVAGCGPIGGLVALL
VSRLHDGPLLVADRNAARLALVAGETGAEPIDLADGAGRVRHAFDATGSVAVVEALVRGL
GGGGGLCLVGISHGAFPLDPNLLVEREIALVGSHAFTDELPEVVAMLEGLSPALRRFVDG
EHGLDDAPAAYARIIAGEATGLKTILRPV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccgtcagactgcacgccgccggggacctccgcgtcgaggacctgcctgagccg
ggcgcgccgggcccgggcgaggtgtcgctgaaggtgctcgccgccgggatctgcggctcg
gacgtgcacaacttccgcaccggccagtggctgaccgggacgccgcgcgtcgccggccac
gagttctcggccgaggttgtggcggtcggcggcggcgtcgcgggcctcgcccccggcgac
agggtggtggccgactcgcgcttctggtgcggcgattgcgacgcctgccgcgccggccgg
cgcaacctctgccgccggctcggcttcgtcggcgaggtctgcgacggcggcttcgcgccg
ttcacggtgctgcccgcgcggctggtcgagaaggtgccggccgggaccgatccggtggcg
gccgcgatggccgagccgctggcggtggcgctgcacgcgatccgccggctgccggtgccg
gccggcgcgccggtgctggtggcgggctgcgggccgatcggcgggctggtggcgctgctc
gtctcgcggctgcacgacggcccgctgctggtcgccgaccgcaacgccgcccggctggcg
ctggtggccggcgagaccggcgccgagccgatcgacctcgcggatggcgccgggcgggtc
cgccatgccttcgacgccaccggcagcgtcgcggtggtcgaggcgctggtgcgtgggctc
ggcggtggcggcgggctctgcctcgtcggcatctcgcacggcgccttcccgctcgacccc
aacctgctggtggagcgcgagatcgccctcgtcggcagccacgccttcaccgacgaactg
cccgaggtggtagcgatgctcgagggcctgtcgccggcactccggcgcttcgtcgacggc
gagcacgggctcgacgacgcgccggccgcctatgcccggatcatcgccggtgaggcgacc
gggctgaagaccatcctgcggccggtctga

DBGET integrated database retrieval system