KEGG   Pleomorphomonas sp. SM30: OHA_1_02745Help
Entry
OHA_1_02745       CDS       T05766                                 

Gene name
putA
Definition
(GenBank) bifunctional protein PutA
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
pleo  Pleomorphomonas sp. SM30
Pathway
pleo00250  Alanine, aspartate and glutamate metabolism
pleo00330  Arginine and proline metabolism
pleo01100  Metabolic pathways
pleo01110  Biosynthesis of secondary metabolites
pleo01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    OHA_1_02745 (putA)
   00330 Arginine and proline metabolism
    OHA_1_02745 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pleo03000]
    OHA_1_02745 (putA)
Enzymes [BR:pleo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     OHA_1_02745 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     OHA_1_02745 (putA)
Transcription factors [BR:pleo03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    OHA_1_02745 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: BBE73139
UniProt: A0A2Z6I4I5
Position
1:complement(2996769..2999876)
Genome map
AA seq 1035 aa AA seqDB search
MTLHALPNRPVFSSPYAPREEDVVRRLIAEVAVSSEARTRVDRHATRLIEGIRNRQSSLG
GVEDFLKAYSLTTKEGLAIMVLAEALLRVPDGATADRLIEDKLAAASFDQPRKGGDPWLV
TASAWALGVTTRIVQPGETPEGVVAGLVKRLGMPPVRAATRQAMRVMGHQFVLGETIEAA
LQRARSAEGKGFRHSYDMLGEGARTAADAERYFASYFRAIDAIGRSAGNEALPARPGISV
KLSALHPRYEAVKADRVDAELVPRLLELARAARAHDLNLTVDAEEADRLTLSLDVIARVA
ADPSLKGWDGFGLAIQAYQKRSAAVVDWVADLASALDRRFMVRLVKGAYWDTEVKRAQER
GLDDYPVFTRKAGTDLSYLACARRMLAARPRIYPQFATHNALTVAEILDLAGADRSFEFQ
RLHGMGEALYAQVTVEEGQPCRIYAPVGGHRDLLAYLVRRLLENGANSSFVSGVGDPNVP
VSQLLTRPEDVLGGGSRARHSRIPMPAAIFAPRLNSRGVELGDDHARSALIAAIERAAAP
APAAAIVDGADAGGPARPVVSPIDGATVVGTVREGDAALVERAVAVAAGGFRAWSATPVE
TRAAVLEKAADLLEADRAAFLAVLAAEAGKTLPDAVAEVREAVDFCRYYAAEARRCFGAD
VVLPGPTGEENRLVQRGRGVFACISPWNFPLAIFLGQVAAALAAGNAVVAKPAEQTPLVA
AAAVRLLHEAGVPLSALQLVTGDGAVGAALTGHPAIAGVAFTGSTETAWAINRGLAAKRG
PIVPLIAETGGLNAMVVDATALGEQVCDDVVTSAFRSAGQRCSALRLLFVQEDVADHMLA
LIAGAAAELVVGDPRDPATDVGPVIDREAKARIDAHVAAWAARGAVRFAGRLPTGALAAG
TYVAPTVIELPSAADLAEEVFGPVLHVVRWKASQLERTIDAIGASGYGLTLGVHSRIDAT
VKRIVERLPVGNVYVNRNVIGAVVGSQPFGGSGLSGTGPKAGGPHYLARFALEQVVSVNT
AAAGGNASLVAMGDE
NT seq 3108 nt NT seq  +upstreamnt  +downstreamnt
atgacactccacgccctgccgaaccgccccgtcttctcctccccgtacgccccgcgcgag
gaggacgtcgtacgccgtctcatcgccgaggtcgcggtctccagcgaagcacgaacgcgc
gtcgaccgccatgcgacacgactgatcgagggcatccggaaccgccagtcgagtctcggc
ggggtcgaggacttcctcaaggcctattcgctgacgaccaaggagggcctcgccatcatg
gtgctggccgaggcgcttctgcgcgttccagacggcgccaccgccgaccgcctgatcgag
gacaagctcgccgccgcctccttcgaccagccgcgcaagggcggcgatccctggctggtc
accgcctcggcctgggcgctcggcgtcaccacccgcatcgtccagcccggcgagacgccg
gagggcgtggtcgccggcctcgtcaagcggctcggcatgccgccggtgcgggcggcgacg
cggcaggcgatgcgcgtgatgggccatcagttcgtactcggcgagacgatcgaggcggcg
ctgcagcgcgcccgctccgccgagggcaagggcttccgccattcctacgacatgctcggc
gagggcgcccgcaccgccgccgacgccgagcgctatttcgccagctacttccgggcgatc
gacgcgatcggccgcagcgcgggcaacgaggcgctgccggcccggcccggcatttcggtc
aagctgtcggcgctgcacccgcgctacgaggcggtcaaggccgaccgcgtcgacgccgaa
ctggtgccgcggctgctcgaactcgcccgcgccgcccgcgcccacgacctcaacctcacc
gtcgacgccgaggaggccgatcgcctgaccctgtcgctcgacgtgatcgcccgcgtcgcc
gccgacccgagcctgaagggctgggacggcttcggcctcgcgatccaggcctaccagaag
cgctcggcggccgtggtcgactgggtcgccgatctggcgagcgcgctcgaccgccgcttc
atggtccgcctcgtcaagggcgcctactgggacaccgaggtcaagcgcgcccaggagcgt
ggcctcgacgactacccggtcttcacccgcaaggccggcaccgacctctcctatctcgcc
tgcgcccgccgcatgctggcggcgcggccgcggatctacccgcagttcgccacccacaac
gccctcacggtggccgagatcctcgacctcgccggtgccgaccgcagcttcgagttccag
cgtctgcacggcatgggcgaggcgctctacgcccaggtcacggtcgaggagggccagccc
tgccggatttacgccccggtcggcggccaccgcgacctgctcgcctatctggtccgccgc
ctgctcgagaacggcgccaactcctccttcgtctccggcgtcggcgatcccaacgtgccg
gtgtcgcagctcctgacccggcccgaggacgtgctcggcggcggcagccgcgcccgccat
tcccgcatcccgatgccggcggcgatcttcgcgccgcggctcaactcgcgcggcgtcgaa
ctcggcgacgaccacgcccgctccgcgctcatcgccgcgatcgagcgcgccgcagcgccg
gcgccggccgccgcgatcgtcgacggcgccgacgccggcggcccggcccgcccggtggtc
tcgccgatcgacggcgccaccgtggtcggcaccgtccgcgagggcgacgccgccctggtc
gagcgcgcggtcgccgtcgccgccggcggtttccgcgcctggagcgcgacgccggtcgag
acccgcgccgccgtgctcgagaaggccgccgacctcctcgaggccgaccgcgccgcgttc
ctcgccgtcctcgccgccgaggccggcaagaccctgcccgacgcggtcgccgaggtccgc
gaagccgtcgacttctgccgctactacgccgccgaggcgcgccgctgcttcggggccgac
gtggtgctgccggggccgaccggcgaggagaatcgcctcgtccagcgcggccgcggcgtc
ttcgcctgcatcagtccgtggaacttcccgctggcgatcttcctcggccaggtcgcggcc
gcgctcgccgccggcaacgccgtggtcgccaagccggccgagcagacgccgctggtcgcc
gccgccgcggtgcgcctcctgcacgaggccggcgtgcccttgtcggcgctgcagctcgtc
accggcgacggcgcggtcggcgccgcgctcaccggccacccggcgatcgccggcgtcgcc
ttcaccggctcgaccgagaccgcctgggcgatcaaccgcggtctcgccgccaagcgcggg
ccgatcgtgccgctgatcgccgagaccggcggcctcaacgccatggtcgtcgacgccacc
gccctcggcgaacaggtctgcgacgacgtcgtcacctcggccttccgctcggccggccag
cgctgctcggcgctgcggctcctgttcgtgcaggaggacgtcgccgaccacatgctggcg
ctgatcgccggcgccgccgccgaactggtcgtcggcgatccccgcgatcccgccaccgac
gtcggcccggtgatcgaccgcgaggccaaggcgcggatcgacgcccacgtcgccgcctgg
gccgcccgcggcgcggtccgcttcgccggccgcctgccgaccggcgcgctcgccgccggc
acctacgtcgccccgacggtgatcgaactgccctccgccgccgatctcgccgaggaggtg
ttcggcccggtgctgcacgtggtgcgctggaaggcgagccagctcgaacgcaccatcgac
gccatcggcgccagcggctacgggctcaccctcggcgtccactcccgtatcgacgccacg
gtgaagcggatcgtggagcggctgccggtcggcaacgtctacgtcaatcgcaacgtcatc
ggcgcggtggtgggatcgcagcccttcggcggctccggcctgtccggcaccggcccgaag
gcgggcgggccgcactacctcgcccgcttcgcgctcgaacaggtcgtctcggtcaacacc
gcggccgccggcggcaacgccagtctggtcgcgatgggagacgagtga

DBGET integrated database retrieval system