KEGG   Pleomorphomonas sp. SM30: OHA_1_03454Help
Entry
OHA_1_03454       CDS       T05766                                 

Definition
(GenBank) 2-oxoglutaramate amidase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
pleo  Pleomorphomonas sp. SM30
Brite
KEGG Orthology (KO) [BR:pleo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OHA_1_03454
Enzymes [BR:pleo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     OHA_1_03454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: BBE73837
UniProt: A0A2Z6I7M1
Position
1:3782816..3783667
Genome map
AA seq 283 aa AA seqDB search
MVRVACVQLRSGRDPAANLAATEALVREAAGRGATYVQTPEMTNILERSREDLFAKIATE
ADDVFLARMRTVAAELGIHLHLGSLALKRADGKVANRGFVIGPDGGILGAYDKIHMFDVD
LAGGESWRESATYTPGTDAVTVDAGGLTVGMAICYDIRFPHLFRAYGHAGVDVVTAPAAF
TRQTGAAHWHVLQRARAIENGCFLVSAAQGGLHEDGRETYGHSLIVDPWGVVIAEADHDE
PGVIVAEIDPAAVAAARGRIPSLKNERPFGLVAPDRARLRSLG
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggtccgcgtcgcctgcgtccagctccgctccggccgcgatccggccgccaatctcgcg
gccaccgaggcgctcgtccgcgaggccgcgggacggggggcgacctacgtccagaccccg
gagatgacgaacatcctcgagcgctcgcgcgaggacctgttcgccaagatcgccaccgag
gccgacgacgtcttcctcgcgcggatgcggaccgtggccgccgagctcggcatccacctc
cacctcggctcgctcgcgctgaagcgggccgacggcaaggtcgccaaccgcggcttcgtg
atcggccccgacggcggcatcctcggcgcctacgacaagatccacatgttcgacgtcgac
ctcgccggcggcgagagctggcgcgagagcgcgacctacacgcccggcaccgacgccgtc
acggtcgacgccggcggcctcacggtcggcatggcgatctgctacgacatccgctttccg
catctcttccgcgcctacggtcacgccggcgtcgacgtggtgacggcgccggccgccttc
acccgccagaccggcgccgcgcactggcacgtgctgcagcgcgcccgggcgatcgagaac
ggctgcttcctcgtctcggctgcccagggcggccttcacgaggacggccgcgagacctac
ggccactcgctgatcgtcgacccctggggcgtggtgatcgccgaggccgaccacgacgag
cccggcgtgatcgtcgccgagatcgaccccgccgccgtcgcggccgcccgcggccgcatc
ccgtcgctgaagaacgagcgcccgttcgggctggtcgcgcccgaccgggcgcggctgcgc
tcgctcggctga

DBGET integrated database retrieval system