KEGG   Pantoea ananatis LMG 5342: PANA5342_0231Help
Entry
PANA5342_0231     CDS       T01728                                 

Gene name
mqo
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00020  Citrate cycle (TCA cycle)
plf00620  Pyruvate metabolism
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01120  Microbial metabolism in diverse environments
plf01130  Biosynthesis of antibiotics
plf01200  Carbon metabolism
Module
plf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
plf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:plf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PANA5342_0231 (mqo)
   00620 Pyruvate metabolism
    PANA5342_0231 (mqo)
Enzymes [BR:plf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     PANA5342_0231 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo
Motif
Other DBs
NCBI-ProteinID: CCF07624
Position
complement(256536..258149)
Genome map
AA seq 537 aa AA seqDB search
MCKSAVNLALMMSVSGKDTTRAQERKDVDVLLIGAGVMSATLGTWLQDLEPDWSIEMVER
LGHVAEESSNGWNNAGTGHAALAELNYTPQRADGSIDIAKAVAINESFQISRQFWAYHVQ
KGNLHTPKSFIHSTPHMSFVWGDDNVAFLRKRFTALQKSTLFRGMVYSEDPQQIAQWIPL
VMKGRASNQKVAATWTDMGTDVDFGEVTRQLIASLEQKANFRLRMHQEVREITRLNDGRW
QVTLVCMKEGTRRTLTAGKIFIGAGGAALPLLQKAGIPEANGYAGFPVGGSFLVTENPDV
VKQHMAKVYGKASVGAPPMSVPHVDTRVLNGKQVLLFGPFATFSTKFLKQGSLLDMFASL
NSTNVMPMIKVGLKSFDLVKYLMDQVLQSDRDRMDALRAYVPQAKQEDWRLVTAGQRVQI
IKKDEKEGAVLRLGTEVVSSEDGSVSALLGASPGASTAAPIMLELLHKVYPEQMASPEWQ
NKIRAVVPSWGRKLNGDVALTEKVLAETSRILQLKYTPVTPVAANDEGRETAYVIGK
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaaatcagctgtaaatcttgcgctcatgatgagtgttagcggaaaggacaccacc
agggcgcaggagcgtaaagacgttgatgtactgcttattggcgcaggcgtcatgagtgct
acgttaggaacctggcttcaggatctggaacctgactggtccatcgaaatggtggagcgg
ctgggacacgtagcggaagagtcttcaaatggctggaacaacgcgggtacaggccatgcg
gcgctggccgagttgaactatacgcctcagcgagccgatggcagtatcgatatcgccaaa
gccgttgcgattaacgagtcattccaaatttctcgccagttctgggcttatcacgttcag
aaaggcaacctgcatacgccgaaaagctttattcacagtactccgcacatgagctttgtc
tggggcgatgataatgtcgcgttcctgcgcaagcgctttactgccttacagaaaagcacg
ctgttccgcggcatggtttactctgaagatccgcaacaaatcgcacagtggattccgctg
gtcatgaaaggccgtgcgtcgaatcagaaagtggcagcaacctggacagacatgggcacc
gacgtcgatttcggtgaagtgacgcgccagctgattgcttcactggagcaaaaagccaac
ttccgtttacggatgcatcaggaagtgcgcgagattacccgccttaatgatggccgctgg
caggtgacgctcgtctgcatgaaagagggtacacgccgcacgttgacggctggaaagatc
tttattggcgcgggcggtgcggcgctgccgctgctgcagaaggccggcattccggaagcc
aacggctatgcgggcttcccggttggcggttccttcctggtcaccgagaatccagacgtc
gtgaaacagcacatggcgaaagtctatggcaaagccagcgtgggcgcgccaccgatgtcc
gtgccccatgtcgatacgcgtgtgctgaacggcaagcaggtgctgctgtttggtcccttt
gcgaccttctcgaccaaattcctgaagcagggctcgctgctggatatgtttgcctcactc
aacagcaccaacgtaatgcccatgatcaaggtcggactgaaaagctttgatctggtgaaa
tacctgatggatcaggtgctgcaaagtgaccgcgatcgtatggatgcactgcgtgcttat
gtgccacaggcgaaacaggaagactggcgcctggtgacggccgggcagcgcgtgcaaatc
atcaagaaagatgagaaagaaggcgcagtgctgcgtttaggcacggaagtggtgtcgtcc
gaagacggctctgtctctgcgttgctgggtgcctcgccaggtgcctcgaccgccgcgccg
attatgctggagctgctgcataaggtctatccggagcagatggcgtcgccggagtggcaa
aataaaatccgtgccgtggtgccgtcctggggccgtaagctgaatggcgatgtggcgttg
actgaaaaagtactggcagaaaccagccgtatcctgcagctcaaatatacgccggttacg
ccagtggctgccaacgatgaaggccgtgaaaccgcctatgtcataggcaaataa

DBGET integrated database retrieval system