KEGG   Pantoea ananatis LMG 5342: PANA5342_1306Help
Entry
PANA5342_1306     CDS       T01728                                 

Gene name
glk
Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf00010  Glycolysis / Gluconeogenesis
plf00052  Galactose metabolism
plf00500  Starch and sucrose metabolism
plf00520  Amino sugar and nucleotide sugar metabolism
plf00521  Streptomycin biosynthesis
plf01100  Metabolic pathways
plf01110  Biosynthesis of secondary metabolites
plf01120  Microbial metabolism in diverse environments
plf01130  Biosynthesis of antibiotics
plf01200  Carbon metabolism
Module
plf_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
plf_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:plf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PANA5342_1306 (glk)
   00052 Galactose metabolism
    PANA5342_1306 (glk)
   00500 Starch and sucrose metabolism
    PANA5342_1306 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PANA5342_1306 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PANA5342_1306 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PANA5342_1306 (glk)
Enzymes [BR:plf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PANA5342_1306 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: CCF08699
Position
1360193..1361158
Genome map
AA seq 321 aa AA seqDB search
MTTYALVGDVGGTNARLALCEVENGSISQAKTFATSDYDSLEAVIRHYLDEQKQDIKDGC
IAIACPITDDWVEMTNHDWAFSTKKLKENIGFEHLEIINDFTAVSMAIPMLGAEHVIQFG
GKEPVKDKPVAIYGAGTGLGVSHLVHVDKRWVSLPGEGGHVDFAANSEEEDQILEVLREE
LGHVSAERVLSGAGLVNLYRAIVKVDHRVPENLKPKEVSERALADSCTDCRRALSLFCVI
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFKSSGFRAAFEDKGRFRDYVATIPVYMIT
HDQPGLLGAGAHLRQTLGRII
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttatgccttggtcggcgatgtcggcggcaccaatgcccgtctcgctttgtgt
gaggtggaaaacggcagcatctcccaggccaaaacattcgcaacatcagactacgacagc
ctcgaagccgtcatccgccactatcttgatgaacaaaagcaggatatcaaagacggttgt
atcgccattgcctgcccgattaccgatgactgggttgagatgaccaaccacgactgggca
ttttcgaccaaaaagctgaaagaaaacatcggttttgaacacctggaaattattaacgac
ttcacagcggtttccatggccatccctatgctgggtgcggaacatgtcattcagtttggt
ggcaaagagccggtcaaggataagcctgtggccatttacggtgcgggtaccgggctgggc
gtgagtcatctggtccatgttgataagcgttgggtcagtctgcccggcgaaggcggccac
gttgactttgcggccaacagcgaagaagaagatcaaatcctcgaagtgttgcgggaagag
ctaggccatgtgtcggccgagcgcgttctgtccggcgcggggctggtcaatctctatcgg
gcgattgtgaaagtcgatcatcgtgtacccgaaaatctcaagcccaaagaagtgagtgag
cgtgcgcttgctgacagctgcaccgactgccgtcgtgcactgtcgctgttctgcgtgatt
atgggacgtttcggcggtaacctggccctgaaccttggcaccttcggtggagtgtacatc
gcgggcggtatcgtgccgcgcttcctggagttcttcaaatcgtcgggcttccgggcggcc
ttcgaagacaaagggcgctttcgcgattatgtcgccacgattccggtctatatgatcacc
cacgatcaacccggattattaggcgctggcgcgcacctgcgccaaacgctgggccgcatt
atctaa

DBGET integrated database retrieval system