KEGG   Pantoea ananatis LMG 5342: PANA5342_1724Help
Entry
PANA5342_1724     CDS       T01728                                 

Definition
(GenBank) type IV/VI secretion system protein, DotU family
  KO
K11892  type VI secretion system protein ImpK
Organism
plf  Pantoea ananatis LMG 5342
Pathway
plf03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:plf00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    PANA5342_1724
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plf02044]
    PANA5342_1724
Secretion system [BR:plf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PANA5342_1724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU OmpA
Motif
Other DBs
NCBI-ProteinID: CCF09117
Position
1821882..1823123
Genome map
AA seq 413 aa AA seqDB search
MMQEQNKPNSDAFQQDLSHQNSLVAAANPLINAIPQIRHSVSHDDPARLRQQLIDQIRRF
ELACQQSGLSYEVIVGARYCLCTALDEAAALTPWGSRGVWTSNGLLVTFHNETWGGEKFF
QLLAKLSQNPRQHILLLELIYFCLLLGFEGRYRVLDNGRSQLDTIKQRLLQMIRSVRGSF
AAALSPHPTDQPVLRKLWRPMIPLWACAALAGLAACLFYIVLNWRLGDYTSPVLAKIYQT
TLPEVQIRNPAPPPPPSLNLKSFLKPEIDEGLVAVRDEADQSVVTLKGDGLFASGSTEVR
GRYDAVIQRVAEAMNNVSGKILVVGYSDNVPIRSARFASNYELSLARAQSVQTLLQKQLA
KPSRVKAEGRGETHPLVPNTSAENRARNRRVEITLQVAPDTTQAEVNGLARGN
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaggaacaaaataaaccgaacagtgatgcttttcagcaggatcttagccaccag
aatagtttggtggctgcagcgaatccgctgattaacgcgattccacagattcgtcactcc
gtctcccatgacgatcccgcacgtttacgtcaacagctgattgaccagatccgccgtttc
gagctggcctgccagcagtccggactgagctatgaggtgatcgttggcgcgcgctattgt
ctgtgtacggcgcttgatgaagccgcagcactgacgccctggggaagccgtggcgtgtgg
accagtaatggcttactggtcaccttccacaacgaaacctggggcggggagaaattcttc
caactgctggcgaaactgtcgcaaaacccgcgtcagcacatcctgttactggagctgatc
tatttctgcttactgcttggttttgaagggcgctatcgggttctggataatggacgctcg
caactggatacgattaaacagcgtctgttgcagatgatcaggagcgtcaggggcagcttt
gccgccgccttgtcgccgcatccgaccgatcagccggttctgcgtaaactctggcgcccc
atgattccgctgtgggcctgtgcggctctggcgggcctggctgcctgcctgttctatatc
gtgctgaactggcgtctgggggattacacctcgcccgtgctggccaaaatctaccaaacg
acgctgccagaagtgcagattcgtaatccggcaccgccgccgccgccgtcactgaacctg
aagtcattcctgaaacctgaaatcgacgaaggcctggtggccgtgcgcgatgaggcagat
caaagtgtggtgacgctgaaaggcgatggcttgttcgcatccggttcgacagaggttcgc
ggacgttatgatgccgttatccagcgtgtagctgaagccatgaataacgtcagcgggaaa
atcctggtggtgggctacagcgataacgtaccgattcgcagtgcccgatttgcctccaac
tatgagctgtctctggcccgtgcccagtctgttcagacgctgttacaaaaacagctggca
aaaccatcacgcgttaaagcggaagggcggggtgaaacgcatccgttggtgccgaatacc
agtgcagaaaatcgcgcgcgtaatcgtcgtgttgaaattacgctgcaggttgcacctgat
acgacgcaagctgaagttaacggcctggcgagagggaactaa

DBGET integrated database retrieval system