KEGG   Pantoea ananatis LMG 5342: PANA5342_1728
Entry
PANA5342_1728     CDS       T01728                                 

Definition
(GenBank) type VI secretion system, core protein
  KO
K11901  type VI secretion system protein ImpB
Organism
plf  Pantoea ananatis LMG 5342
Brite
KEGG Orthology (KO) [BR:plf00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:plf02044]
    PANA5342_1728
Secretion system [BR:plf02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   PANA5342_1728
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: CCF09121
Position
1828595..1829125
AA seq 176 aa
MPTMKSSGQKFIARNRAPRVQIEYDVEVYGAERKIQLPFIMGVLADLAGKPLEPQASVDD
RKFMEIDIDNFDERMKAMKPRAAFQVDNTLNGDGKLNIDLTFESMDDFSPDAIARKVDPL
NSLLEARTQLSNLLTYMDGKNGAEELIGKILQDPTLLQALSHVPKQTDAPEGKEEQ
NT seq 531 nt   +upstreamnt  +downstreamnt
atgccaacaatgaagtccagtgggcagaaatttatcgcccgcaatcgcgcgccacgcgtt
cagattgaatatgacgtggaagtctatggcgcagaacgtaaaattcagctgccattcatc
atgggtgttctggccgatttagccggtaaaccgctggagccgcaggccagcgttgacgac
cgtaaattcatggaaatcgacatcgacaatttcgatgagcgtatgaaagccatgaagcca
cgtgcggcattccaggtagacaatacgttgaacggtgacggcaaactgaacatcgatctg
accttcgaaagcatggacgatttttctcctgatgccattgcacgcaaagtcgatccactc
aacagcctgcttgaagcacgtacccagctctccaacctgctgacctatatggacggcaaa
aacggcgccgaagagctgatcggcaagattttacaggatccgacactgctgcaggccctg
tcacacgtgcctaagcaaacggatgcccctgaaggtaaggaggagcagtaa

DBGET integrated database retrieval system